Details for Soybean Locus Glyma.09G182600

Position : Chr09 ( 5`- 40778825 .. 40790611 -3` )
Annotation :
External links : CoGe
PGDD synteny : Glyma.09G182600

Protein [Map View]
MATPLTGLNGGGGGVAVLTNPVNKVDSSANGGGGFGRSLSESPILIFSFFHKAIRNELDALHRLAMAFATGNCSDIQPLF
QRYRFLRSMYSHHSNAEDEVIFPALDMRVKNVAQTYSLEHQGESDLFDHLFELLNSSIHNDESFPKELASCTGALQTSVS
QHMAKEEEQVFPLLLEKFSLEEQASLVWRFLCSIPVNMMTEFLPWLSSSISPDESQDLQKCLSKIVPEEKLLQKVIFTWM
EGRSSANTVENCLDHSQVRCSPNPLTHQNGKIKCACESTATGKRKYSGSSIDVSDTMRTHPIDEILLWHNAIKKELNEIA
AQSRKIQLSGDFTNLSAFNERLQFIAEVCIFHSIAEDKVIFPAVDGKFSFYQEHAEEESQFNEFRSLIESIQSEEATSSS
ETEFYSTLCSHADHILEMIQRHFHNEEVQVLPLARKHFSFKRQRELLYQSLCMMPLKLIERVLPWLIRSLTEDEAQMFLK
NMQLAAPAIDSALVTLFCGWACKARKDGLCLSSSVSGCCPAQRFTDIEENTVQSSCTSASALSGRVCSVLAESDGTQQRS
VKRNISEVHKNEDVSKTSEIESIQKQCCSARSCCVPALGVNKNNLGLGSLSTTKSLRSLSFTASAPSLNSSLFIWETDNS
SCDVGSTERPIDTIFKFHKAIRKDLEYLDIESGKLCDGDETIIRQFSGRFRLLWGLYRAHSNAEDDIVFPALESKEALHN
VSHSYTLDHKQEEKLFEDISCVLSELSVLHENMQMTHMSVDLSENDFGISDANDNIKEYNELATKLQGMCKSIRVTLDQH
IFREELELWPLFGKHFTVEEQDKIVGRIIGTTGAEVLQSMLPWVTSALTQDEQSKMMDTWKQATKNTMFNEWLNECLKET
PVSTSQTEASERSTSQRGGDYQENLNLNEQMFKPGWKDIFRMNQNELESEIRKVYRDSTLDPRRKAYLVQNLMTSRWIAA
QQKLPKALSGESSKQIEGCSPSFRDPEKEIFGCEHYKRNCKLRAACCGKLFTCRFCHDNASDHSMDRKATLEMMCMQCLT
IQPVGPICMSPSCNGLTMAKYYCNICKFFDDERNVYHCPFCNICRVGQGLGIDYIHCMKCNCCLGIKSASHKCLEKGLEM
NCPICCDDLFTSSATVRALPCGHYMHSSCFQAYTCSHYTCPICSKSLGDMAVYFGMLDALLAAEELPEEYRDRYQDILCH
DCDRKGTSRFHWLYHKCGSCGSYNTRVIKSEATNSSCL*

DNA
ATGGCGACGCCGCTGACGGGACTGAACGGCGGCGGCGGCGGAGTGGCGGTGCTGACGAATCCGGTGAACAAGGTGGATTC
CTCCGCCAATGGCGGTGGCGGATTCGGCCGGTCGCTGTCGGAGTCGCCAATTCTGATATTCTCGTTCTTCCACAAGGCGA
TTCGGAACGAGCTCGACGCGCTGCACCGATTGGCGATGGCGTTCGCCACCGGAAACTGCTCCGACATCCAGCCCCTCTTC
CAACGCTACCGTTTCCTCAGATCGATGTATAGCCACCACTCCAATGCCGAAGATGAGGTGATTTTTCCAGCTCTAGATAT
GCGTGTGAAGAATGTAGCACAGACATATTCCCTTGAACACCAGGGTGAAAGTGATCTTTTTGATCATCTATTTGAGCTGT
TAAACTCTTCTATCCATAATGATGAAAGTTTCCCAAAGGAGTTAGCATCCTGCACAGGAGCTCTGCAGACGTCAGTTAGT
CAACACATGGCTAAGGAAGAGGAGCAGGTATTTCCACTGCTTCTTGAGAAGTTCTCTCTTGAGGAACAGGCATCTTTAGT
TTGGCGGTTTCTCTGCAGTATTCCTGTGAATATGATGACAGAATTTCTTCCATGGCTTTCATCATCTATATCACCTGATG
AATCTCAGGATTTGCAGAAGTGCTTAAGCAAGATAGTGCCGGAGGAAAAGCTTCTTCAAAAGGTTATTTTCACCTGGATG
GAAGGGAGAAGTAGTGCTAACACAGTTGAAAATTGTTTAGATCATTCTCAGGTGCGATGTAGTCCTAATCCTTTAACCCA
TCAGAATGGGAAAATAAAATGTGCATGTGAGTCCACAGCAACTGGGAAAAGGAAATATTCTGGATCTAGCATAGATGTTT
CTGATACCATGAGAACACATCCTATAGATGAAATATTGCTCTGGCATAATGCAATAAAAAAAGAGTTAAATGAGATAGCA
GCACAGTCTAGAAAGATACAACTCTCTGGAGATTTCACTAACCTGTCAGCTTTCAATGAAAGGTTGCAGTTCATTGCTGA
AGTTTGCATATTTCACAGTATTGCAGAGGACAAGGTTATTTTTCCAGCAGTAGATGGAAAGTTTTCTTTCTATCAAGAAC
ATGCTGAAGAAGAAAGCCAATTTAATGAGTTCCGGTCTTTGATTGAAAGTATTCAAAGTGAAGAAGCAACATCTAGTTCA
GAAACTGAATTTTATTCAACATTGTGTTCACATGCTGACCATATATTGGAAATGATACAGAGACATTTCCATAATGAAGA
AGTTCAGGTTCTTCCTCTTGCACGGAAGCACTTTAGCTTCAAAAGGCAACGTGAACTTCTCTATCAAAGCTTATGCATGA
TGCCTTTGAAATTGATTGAGCGTGTCCTGCCATGGTTGATTCGATCATTAACTGAAGATGAAGCACAGATGTTTTTGAAA
AACATGCAATTAGCAGCTCCAGCAATAGATTCTGCTTTAGTCACACTTTTCTGTGGTTGGGCTTGCAAGGCTCGTAAAGA
TGGTCTGTGTTTGTCTTCAAGTGTATCAGGTTGCTGTCCGGCCCAGCGATTTACCGATATTGAAGAAAATACTGTTCAAT
CTTCCTGTACTTCTGCTTCTGCATTGTCTGGTAGAGTTTGCTCGGTATTAGCTGAATCAGATGGGACCCAACAAAGATCA
GTCAAGCGAAACATATCAGAGGTGCACAAGAATGAAGATGTCTCTAAAACTTCAGAAATTGAAAGTATTCAGAAACAATG
TTGTAGTGCCCGGTCTTGTTGTGTGCCAGCTTTAGGAGTCAACAAGAATAATTTGGGGCTGGGTTCACTCTCTACAACCA
AGTCCTTACGCTCTTTGTCTTTCACTGCTTCTGCCCCATCCCTTAATTCTAGTCTTTTCATATGGGAAACAGACAACAGT
TCATGTGATGTTGGCTCTACAGAAAGACCAATTGATACCATATTTAAATTCCATAAAGCCATACGCAAAGACTTGGAGTA
TTTAGACATTGAATCTGGAAAGCTTTGTGATGGTGATGAAACAATTATTCGGCAATTTAGTGGAAGATTCCGGCTTTTGT
GGGGCTTATATAGAGCTCATAGTAATGCTGAAGACGATATAGTATTTCCTGCCCTCGAATCCAAAGAGGCACTTCATAAT
GTGAGCCATTCTTACACGCTGGACCATAAGCAGGAAGAAAAATTATTTGAAGATATTTCATGCGTTCTTTCTGAGCTTTC
TGTCCTTCATGAAAACATGCAAATGACCCATATGTCAGTGGATTTAAGTGAAAATGATTTTGGAATTTCTGATGCCAATG
ATAATATCAAAGAGTACAATGAGCTTGCAACTAAGCTTCAAGGGATGTGCAAATCTATTAGAGTGACCCTGGATCAACAT
ATTTTTAGGGAAGAGCTCGAGCTCTGGCCATTGTTTGGAAAACATTTCACTGTGGAAGAACAAGACAAGATAGTGGGCCG
GATAATTGGAACTACAGGTGCTGAAGTTCTCCAATCAATGTTACCATGGGTAACTTCTGCACTTACACAGGATGAACAGA
GCAAAATGATGGATACATGGAAACAGGCAACTAAAAACACCATGTTCAATGAATGGCTAAATGAATGCTTGAAAGAAACT
CCTGTATCTACATCACAGACAGAAGCGTCAGAGCGTAGCACTTCTCAAAGAGGTGGTGATTATCAAGAAAACTTGAACCT
GAATGAGCAGATGTTCAAGCCAGGTTGGAAAGACATATTCCGTATGAATCAGAATGAACTTGAGTCAGAAATCCGGAAGG
TTTATCGCGACTCAACTCTTGATCCAAGGAGAAAGGCATACCTTGTGCAGAATCTAATGACAAGTCGCTGGATAGCCGCC
CAACAGAAGTTACCTAAGGCTCTATCTGGGGAGTCTAGCAAACAAATAGAAGGATGCTCACCATCATTTCGGGACCCAGA
GAAAGAAATATTTGGTTGTGAGCACTATAAGCGAAATTGCAAGCTTCGAGCTGCTTGTTGTGGCAAGTTATTTACTTGCA
GATTTTGTCATGACAATGCAAGTGATCACTCAATGGATAGAAAAGCAACATTGGAAATGATGTGTATGCAGTGCCTAACT
ATACAGCCAGTTGGGCCTATATGCATGTCACCTTCATGTAATGGACTTACAATGGCAAAGTATTATTGCAACATTTGCAA
ATTTTTTGATGATGAAAGGAATGTTTATCATTGCCCATTTTGCAATATATGCCGTGTTGGACAAGGGCTTGGGATTGATT
ATATTCATTGTATGAAATGCAATTGTTGCCTGGGGATAAAATCAGCATCTCACAAGTGCCTGGAGAAAGGCTTAGAAATG
AACTGCCCAATTTGCTGCGACGACCTGTTCACATCAAGTGCAACAGTGAGAGCTTTACCTTGTGGGCATTACATGCATTC
ATCTTGCTTTCAGGCGTACACTTGTAGCCACTACACATGTCCAATCTGCAGCAAATCATTGGGAGATATGGCGGTTTACT
TTGGTATGCTTGATGCTTTATTGGCTGCTGAGGAGCTTCCTGAAGAGTACAGGGATCGCTATCAGGATATACTCTGCCAT
GACTGTGATAGAAAGGGCACTTCACGCTTTCACTGGCTATATCACAAATGTGGATCTTGTGGCTCATACAATACCCGTGT
AATCAAGAGTGAGGCAACAAATTCTAGCTGCCTTTAG