Details for Soybean Locus Glyma.09G180800

Position : Chr09 ( 5`- 40574739 .. 40579272 -3` )
Annotation :
External links : CoGe
PGDD synteny : Glyma.09G180800

Protein [Map View]
MMNDTSSDSENEIIGSRAKLFGHEEPIHEVLGGGKVADVLLWKDRYVSGALLGGMTVIWFLFEIVEYNFVALLCHISITT
MLVLFIWSTVADIFKWKGPQIPDIVLKESFFHDLASILHKRFNQLLPMLLRISCGIDLPIFLLNIVSLYILSVIGSYFSF
VNLLYIGFLCMQTLPIVYERYEEEINNWVGDVIIVLKKNYRRFNKNYLNKIPRGPGKAKKTQ*

DNA
ATGATGAACGATACATCATCTGATTCTGAAAATGAAATTATCGGATCACGGGCAAAGCTCTTTGGACACGAAGAACCGAT
TCATGAAGTTCTTGGAGGAGGAAAAGTGGCAGATGTGTTATTATGGAAGGACAGATATGTATCAGGTGCGCTTTTGGGTG
GGATGACTGTGATATGGTTTCTATTTGAGATCGTTGAGTACAATTTCGTGGCTCTCCTTTGTCACATTTCCATCACCACC
ATGCTTGTACTATTCATATGGTCCACGGTTGCAGACATATTTAAGTGGAAAGGTCCCCAGATACCGGACATTGTTTTAAA
GGAATCATTCTTCCATGATCTTGCTTCCATCCTCCACAAAAGATTTAACCAGTTATTACCAATGCTCCTCCGCATTTCAT
GCGGAATAGACCTTCCAATCTTTCTTCTGAACATTGTTTCCCTCTATATTCTGTCAGTGATTGGAAGCTACTTCAGCTTT
GTCAATCTGCTATATATTGGTTTTCTCTGCATGCAAACGCTGCCAATTGTGTATGAACGGTATGAGGAAGAAATCAACAA
CTGGGTCGGCGATGTCATAATAGTTCTCAAGAAAAACTATAGAAGGTTTAACAAGAACTACCTCAACAAAATTCCCAGAG
GACCAGGGAAGGCAAAGAAAACCCAATAA