Details for Soybean Locus Glyma.09G180400

Position : Chr09 ( 5`- 40548850 .. 40551771 -3` )
Annotation :
External links : CoGe
PGDD synteny : Glyma.09G180400

Protein [Map View]
MNANLLRNLSFHARRLRFSPTPSIFSPTATAPTSFSSRSHVPDKPHSLLEDISNEELKRRVAKLQEGDAEAIPSVFEAIL
QRYLAGKPIEADEELMREILGKRALSEDEEDESDSDWEEIDDTDNDDEEDFDPGFNGRNGVDEGKYKR*

DNA
ATGAACGCAAACCTTCTCAGAAACTTGTCCTTCCACGCGCGCCGTCTTCGTTTCTCTCCCACTCCTTCCATCTTCTCTCC
TACAGCTACAGCACCCACCTCCTTCTCTTCTCGCTCCCATGTCCCCGACAAACCCCACTCCCTCCTTGAAGACATTAGCA
ACGAAGAGTTGAAGAGGCGTGTGGCAAAGCTTCAAGAGGGGGATGCTGAGGCAATTCCTTCTGTGTTTGAGGCTATATTG
CAGAGGTATTTAGCAGGGAAGCCTATAGAAGCTGATGAGGAGTTGATGAGGGAAATTCTAGGGAAGCGGGCATTGTCGGA
AGATGAAGAGGACGAGTCTGATTCTGATTGGGAGGAAATAGATGACACTGATAATGATGATGAAGAAGATTTTGATCCTG
GTTTTAATGGAAGGAATGGAGTTGATGAAGGAAAATATAAGAGATGA