Details for Soybean Locus Glyma.09G180100

Position : Chr09 ( 5`- 40521376 .. 40524186 -3` )
Annotation :
External links : CoGe
PGDD synteny : Glyma.09G180100

Protein [Map View]
MDPPPLSATTQKNHPDSVESFSPRSRNSETWNDETLPAVPGAKLRLMCSYGGHIMPRPHDKSLCYVGGDTRIVVVDRHSS
LKDLCARLSRTILNGRPFTLKYQLPNEDLDSLITVTTDEDLDNMVEEYDRIMAKGSASSRLRLFLFFTKPEATVSMGSLL
DDSKSETWFVDALNNSGMISRVVSDSAAGDSFVNLDGVGVGVGVGVSASGSSNNLEALPDANNCKVKNLPEVVQVQSTPG
SPMMENNSSSSPSFSPSLANLPPIRVRVDDNGSRLHQENKVGMVVEEQFAQMTIASGVKPDDGLVNVVSSTVPVPVIPAA
VTMASVGVITTSDNVMNRVVYEDERSDPGFRKPPLPMQLVQPRTSGGVGLPSPDSVASDSSIASANSFSKTVYYQDQVQA
TLLDNKVVAAMPNAKSEISDQMIQVQGQLQDSGYTLPPQLDQTKQQFQQQQPLIHANNHYIHHPAATGPVPVSSYYPVYA
PPPQLQQLHPHISQQQYPVYVMPVGPTQVTQPYNMALQHNISDPNVVASSRPLMPQSVVTSAAYKDGTPPIYSTKSLSPT
MAPSNPGYAPIPTNQFQPQYVGLSQFHHQPQSIAVAPSSTTTTTTNYGYEYGGHVQDQAYYTQQQTTNATLLPQYQSMTP
AAAAAALSDASKQFPADNIQQPNRASQPV*

DNA
ATGGATCCTCCACCCCTCTCTGCCACCACTCAAAAAAACCATCCTGACTCAGTAGAGTCTTTCTCTCCACGTTCCCGAAA
CTCGGAAACGTGGAATGATGAGACTCTACCGGCCGTTCCTGGCGCCAAGCTGCGCCTCATGTGCAGCTACGGTGGCCACA
TCATGCCACGCCCTCACGATAAGTCTCTCTGCTATGTCGGCGGTGACACGAGGATCGTCGTTGTGGACCGCCATTCGTCG
TTGAAAGACTTGTGTGCAAGGCTTTCCCGAACCATTCTCAATGGAAGACCCTTCACACTCAAGTACCAGCTTCCCAATGA
AGACCTTGATAGCCTAATCACTGTTACCACTGACGAAGACCTTGACAACATGGTGGAAGAGTATGATCGTATAATGGCAA
AAGGTTCGGCTTCTTCGCGGCTCAGGTTGTTCTTGTTCTTCACCAAACCTGAGGCCACAGTTTCAATGGGGTCACTCCTT
GATGATTCCAAGTCAGAGACATGGTTTGTTGATGCACTTAACAACTCTGGCATGATATCAAGAGTGGTGTCAGATTCTGC
TGCAGGGGATTCCTTTGTTAACCTTGATGGTGTTGGTGTTGGTGTTGGTGTTGGTGTTAGTGCTAGTGGTTCAAGCAACA
ACTTGGAGGCTTTGCCTGATGCTAACAACTGCAAGGTTAAGAATTTGCCTGAAGTGGTGCAAGTGCAATCAACACCTGGT
TCACCTATGATGGAGAACAACAGTTCTTCTTCTCCTTCTTTCTCTCCTTCTCTAGCTAATCTACCTCCGATTCGGGTTCG
TGTTGATGACAATGGTAGTAGGCTTCATCAAGAGAACAAGGTCGGGATGGTGGTGGAGGAGCAGTTTGCTCAGATGACAA
TTGCAAGTGGGGTGAAGCCAGATGATGGATTGGTGAATGTTGTTTCTTCTACAGTGCCTGTGCCTGTAATTCCTGCAGCT
GTGACCATGGCATCAGTTGGGGTGATTACTACTAGTGATAATGTGATGAATAGAGTTGTTTATGAGGATGAGAGGTCAGA
TCCTGGGTTTCGGAAGCCCCCTTTGCCAATGCAGCTTGTGCAGCCTAGGACTAGTGGTGGCGTGGGTTTGCCTTCTCCTG
ATTCAGTAGCAAGTGATAGTAGTATTGCATCTGCAAATTCTTTCTCCAAGACTGTTTACTACCAAGATCAAGTCCAAGCC
ACACTACTAGACAACAAAGTTGTTGCTGCTATGCCAAATGCAAAGAGTGAAATATCTGATCAGATGATTCAGGTCCAAGG
ACAACTTCAAGATTCTGGCTACACATTACCCCCACAATTGGATCAAACCAAGCAACAATTCCAGCAGCAGCAGCCATTGA
TCCATGCCAACAATCACTACATCCACCACCCTGCAGCCACAGGTCCAGTGCCAGTTTCATCATACTACCCAGTTTATGCC
CCACCACCACAACTACAACAACTTCACCCTCATATAAGTCAACAACAGTACCCAGTTTATGTGATGCCTGTTGGACCTAC
ACAAGTAACACAACCCTACAACATGGCATTGCAGCACAATATTTCTGACCCTAATGTGGTAGCTTCAAGCAGGCCATTAA
TGCCACAAAGTGTTGTTACCTCAGCAGCATACAAAGATGGTACTCCACCTATTTACTCCACCAAGTCACTTAGCCCAACT
ATGGCTCCATCAAATCCTGGATATGCTCCAATACCTACCAACCAATTTCAGCCACAGTATGTGGGTTTGTCTCAGTTCCA
TCATCAACCACAGTCCATTGCTGTGGCTCCCTCTAGTACTACTACTACTACTACTAATTATGGCTATGAATATGGTGGCC
ATGTGCAAGATCAAGCTTACTACACTCAACAACAAACCACTAATGCTACATTGCTTCCTCAGTACCAATCCATGACCCCA
GCTGCAGCTGCTGCAGCACTATCAGATGCTTCAAAACAGTTTCCTGCAGACAACATTCAGCAGCCAAATAGAGCATCACA
ACCAGTATGA