Details for Soybean Locus Glyma.09G179300

Position : Chr09 ( 5`- 40402524 .. 40409805 -3` )
Annotation :
External links : CoGe
PGDD synteny : Glyma.09G179300

Protein [Map View]
MSLQGSDRRDEPSSGSAGGNGAVAAAAASLRLRLNPNKEHKPDGYEDMQLDFSPNIFSSLERYLPPSMLNVPRDEKANFM
REILLKYLPLGERNRAQKHREYRERIIANYQPLHRELYSVDPATFFVPTFLRAINDNTEQSIRSIVSEPSPGIFIFDIFQ
THFCELLLSEIENFEKWVNETKFRIMRPNTMNKFGAVLDDFGLETMLDKLMEGFIRPLSRVFFAEVGGSTLDSHHGFVVE
YGKDRDVDLGFHVDDSEVTLNVCLGKQFSGGELFFRGIRCEKHVNTGTHSEEIFDYSHVLGRAVLHRGRHRHGARATTSG
NRVNLLLWCRSSVFREMKRYQKDFSNWCGECNREKKERQRSTVAATKLDLFRRQGESTA*

DNA
ATGTCGCTCCAGGGAAGCGACCGCCGCGATGAACCATCTTCGGGCAGCGCCGGCGGAAACGGCGCCGTGGCGGCGGCAGC
GGCGAGCCTGAGGCTGCGGCTGAACCCTAACAAGGAGCACAAGCCCGACGGGTACGAGGACATGCAATTGGATTTCAGCC
CTAACATTTTCAGCTCGCTGGAGAGGTACCTGCCTCCGAGCATGCTCAACGTGCCGCGTGACGAGAAGGCCAATTTCATG
CGCGAGATTCTCCTCAAGTATCTGCCCCTCGGGGAACGCAACAGAGCTCAAAAGCATAGAGAATATAGAGAGAGGATAAT
AGCAAATTATCAGCCTCTACATCGGGAGTTGTACTCTGTGGATCCTGCTACATTCTTTGTCCCCACATTTCTGAGAGCAA
TTAATGATAATACGGAACAAAGTATTAGAAGTATAGTGTCTGAGCCCTCTCCAGGCATTTTTATATTTGACATATTTCAG
ACCCACTTTTGTGAGTTATTGCTATCTGAGATTGAAAATTTTGAGAAGTGGGTGAATGAAACTAAATTTCGGATCATGCG
TCCGAATACAATGAATAAATTTGGTGCTGTACTTGATGACTTTGGACTTGAAACAATGCTTGACAAGCTTATGGAAGGTT
TTATCCGTCCTTTATCTAGAGTCTTCTTTGCAGAAGTTGGCGGGTCAACCCTGGATTCTCATCATGGTTTTGTTGTAGAA
TATGGTAAAGATAGAGATGTTGACTTGGGTTTCCATGTGGATGACTCAGAAGTAACCTTAAATGTTTGTTTGGGTAAGCA
ATTTTCTGGAGGGGAATTGTTTTTTCGGGGCATACGATGTGAGAAACATGTAAATACTGGAACTCATTCAGAGGAGATCT
TTGATTATTCTCATGTCCTTGGACGAGCTGTCCTTCATCGTGGTCGTCATCGCCATGGAGCTAGAGCTACAACATCTGGT
AATCGGGTCAACCTACTTCTATGGTGCAGAAGTTCTGTCTTTAGAGAGATGAAAAGGTATCAAAAAGATTTCTCCAACTG
GTGTGGCGAGTGCAATCGTGAGAAAAAGGAAAGGCAGCGCTCCACAGTTGCTGCTACCAAATTGGATTTGTTCAGGAGGC
AAGGTGAATCCACTGCATAA