Details for Soybean Locus Glyma.09G178000

Position : Chr09 ( 5`- 40279869 .. 40286232 -3` )
Annotation :
External links : CoGe
PGDD synteny : Glyma.09G178000

Protein [Map View]
MTPRVDDFEKDDLSASDDDDDDDDDGLKEDMAALARACTIAVPCPDDNSTAEDDVPAEDPLLHAGDSIVPAATDSDDDQD
DLECLKRVQSLYQPLSVLPPLTPPAAVSDDDDDGVDDLETVRAIMKRFSTYGEGSHEGGMQMLVEGDQTSSPGYEGDIAN
GSIHYESDAGELCPVSQDPNEAATEELIENVEMKLSDFVESSEPDAYESSKLPQKRLSCPPVVRCFVDAINKNRDLQRFI
RSKLIELEAKIEENKKIRNKIKILKDFQASCTRRTGNALSMKKDPRVQLISSKKPFAPKNSKQKHKKASAMCYGPEENSH
VANYRMVLERFPLSLDRKKWSSVERESLLKGIKQQFQEMVLQLSLSVDSSEGLLGDANDMDNVIASVKDLEITPERIRQF
LPKVNWDLIASMYVGGRNGAECESRWLNCEDPLINQGAWTNEEDKSLLLIVQDMGIRNWFDIAASLGTSRTPFQCLARFQ
RSLNPAMLNSEWTEEEDSQLCSAVACFGARDWQSVASVLERRTGTQCSNRWKKSICPEKKGSFTQEEDIRLTVAVMLFGR
KWNQIANYVPGRIQSQCRDRYLNSLDPSLKWGGWTEEEDLRLEAAIVKHGYCWSKIAEEVPPRTDSQCRKRWKVLCPECV
PLLQEARKKRRSIIGSNFVDRESERPAITLNDFLPSPALAPKSDVGASNLCKKRKSSNVPKETSKKCIKRTRLRTKEVQD
TEVYSDDGIKTCGEVVSACRNVSKKMRSKRHTKNTQNCPKEVVDISCSDKVKTCIESSESQSTFIASSGNQDSDNITIVC
FLRDKSKEMLSRFTKDLCQASFSARITDVSRQVESQDPFDDQIISLSQSCDTVGTKNLFVQQKAASDTLVGTPEDANTLT
GNDDDMTLACFLGNKPKKGSQAANRRSACSSTIIIPDGSGLSRSKHVEEETVLHGGVAEPMDIVVEKKDDELLTSLQNRP
TRQRKRPSRFL*

DNA
ATGACTCCTCGCGTCGACGATTTCGAAAAGGACGATCTCTCCGCCTCCGACGACGACGATGACGATGATGACGACGGCCT
CAAGGAGGACATGGCCGCGCTCGCCCGAGCCTGCACGATCGCCGTCCCGTGCCCCGACGATAATTCCACCGCCGAAGATG
ATGTTCCGGCGGAGGACCCGCTCCTCCACGCCGGAGACTCGATCGTTCCCGCCGCCACCGACTCCGACGACGACCAGGAC
GACCTCGAGTGTCTCAAGAGAGTGCAGAGCCTCTACCAGCCTCTGTCCGTTCTTCCGCCGCTGACGCCGCCGGCTGCCGT
GTCCGACGACGACGATGACGGCGTGGACGACCTCGAGACGGTGCGCGCGATTATGAAAAGGTTTAGTACCTACGGCGAAG
GTTCTCATGAAGGTGGAATGCAAATGTTGGTTGAGGGGGATCAGACCTCCAGCCCAGGCTATGAGGGTGACATCGCTAAC
GGCTCAATCCATTACGAATCAGACGCTGGTGAATTATGTCCTGTTTCTCAAGATCCCAACGAGGCTGCCACCGAGGAGTT
GATTGAGAACGTTGAAATGAAGCTTAGTGATTTTGTTGAGAGTTCTGAACCTGATGCCTATGAGTCATCCAAATTACCAC
AGAAAAGATTGAGCTGTCCTCCTGTAGTTCGGTGTTTTGTTGATGCCATTAATAAAAATAGGGATTTGCAGAGATTTATT
AGAAGCAAGTTGATTGAGCTTGAGGCTAAAATTGAGGAAAACAAAAAGATAAGGAACAAAATTAAAATTCTCAAGGACTT
CCAGGCTTCATGCACTAGAAGAACAGGGAATGCGTTATCAATGAAAAAAGATCCACGTGTTCAGTTAATATCTTCAAAAA
AGCCATTTGCTCCAAAGAACTCTAAGCAGAAACATAAAAAAGCCTCTGCAATGTGTTATGGCCCGGAAGAGAATTCTCAT
GTTGCTAATTATAGGATGGTATTGGAAAGATTTCCACTTTCATTGGATCGGAAAAAATGGTCTAGTGTAGAAAGGGAAAG
TCTTTTGAAGGGAATTAAGCAACAATTCCAAGAAATGGTGCTTCAACTTTCACTTTCAGTTGATAGTTCAGAGGGCTTGC
TTGGAGATGCAAATGACATGGATAATGTAATTGCATCTGTGAAAGATCTTGAAATCACACCAGAGAGGATTAGACAATTT
TTACCTAAAGTTAATTGGGATCTCATAGCTTCAATGTATGTTGGTGGCCGTAATGGTGCTGAATGTGAATCAAGGTGGTT
GAATTGTGAAGATCCTTTGATCAACCAAGGTGCATGGACAAATGAAGAGGACAAGTCTCTTTTACTTATTGTCCAAGATA
TGGGCATCAGGAACTGGTTTGATATTGCTGCATCATTGGGCACAAGCAGGACTCCATTTCAATGCTTGGCACGATTCCAA
AGGAGCTTAAATCCTGCCATGCTAAATAGTGAATGGACTGAGGAAGAAGATTCTCAACTCTGTTCTGCTGTGGCATGTTT
TGGTGCTAGGGATTGGCAATCCGTGGCTTCTGTTTTAGAACGGCGGACAGGAACCCAGTGCTCAAATAGATGGAAAAAAT
CCATTTGTCCTGAGAAGAAAGGGAGCTTTACACAAGAGGAGGATATACGCTTAACAGTAGCAGTTATGCTTTTTGGACGG
AAATGGAACCAGATAGCTAACTATGTTCCTGGCCGGATCCAATCTCAGTGTAGGGACAGATACCTCAATAGTTTGGATCC
TTCTTTGAAATGGGGTGGATGGACTGAGGAAGAGGATTTAAGATTAGAAGCTGCAATTGTCAAGCATGGATACTGCTGGT
CTAAGATTGCTGAAGAAGTGCCACCTCGTACTGATTCTCAATGCCGGAAGAGATGGAAGGTGTTATGTCCTGAATGTGTT
CCTTTGCTTCAAGAAGCAAGAAAGAAGCGAAGGTCTATTATTGGTAGTAACTTCGTTGACCGAGAATCTGAACGCCCAGC
CATTACACTGAATGATTTTCTACCTTCACCCGCGTTAGCTCCAAAATCTGATGTTGGTGCTTCAAATCTCTGCAAGAAGC
GCAAGTCAAGCAATGTTCCCAAGGAAACGAGTAAGAAATGCATAAAAAGAACTCGACTTCGTACCAAGGAAGTACAAGAT
ACAGAGGTATATAGTGATGATGGGATCAAGACTTGTGGTGAAGTCGTCTCTGCATGCAGAAATGTTTCCAAGAAGATGAG
GTCCAAAAGACATACAAAAAACACCCAAAATTGTCCCAAGGAGGTAGTGGATATATCTTGTAGTGACAAGGTCAAGACTT
GTATTGAGAGTTCAGAAAGTCAATCTACCTTTATTGCAAGTTCTGGAAATCAAGATTCAGACAACATAACTATTGTATGC
TTTTTACGCGATAAATCAAAGGAGATGCTATCTAGATTTACCAAAGACTTGTGTCAGGCTTCCTTCTCCGCCAGGATTAC
AGATGTTTCTAGGCAGGTTGAAAGTCAAGACCCATTTGATGATCAAATCATCAGCTTGTCTCAGTCATGTGATACTGTTG
GAACTAAAAATTTGTTCGTGCAGCAGAAGGCTGCTTCTGATACACTAGTGGGAACACCAGAGGATGCGAACACTTTGACA
GGCAATGATGATGATATGACCCTTGCGTGTTTTCTGGGAAACAAACCAAAGAAAGGGAGTCAAGCTGCTAACAGGCGTAG
TGCATGCTCTTCAACCATCATCATACCCGATGGCAGTGGACTGTCAAGGTCAAAGCATGTTGAAGAGGAGACTGTTTTGC
ATGGTGGTGTTGCTGAGCCAATGGACATCGTTGTGGAAAAAAAGGATGATGAGCTTCTTACTTCCTTGCAAAACAGGCCA
ACAAGGCAGCGAAAACGACCCAGTAGGTTTTTATGA