Details for Soybean Locus Glyma.09G177500

Position : Chr09 ( 5`- 40196451 .. 40202268 -3` )
Annotation :
External links : CoGe
PGDD synteny : Glyma.09G177500

Protein [Map View]
MEPSSISPPPAPPATAVPFPAEPNDHLPPPIPEPPSNHPPYAEMIYTAIEALKEKDGSSKRAIAKYIEQVYTQLPPNHSD
LLTQHLNHLKSRGLLQMVKKSYALPRSVPVSVPGPAPTQGTSAVPAAVVAITTTPRPRGRPRKAQNPVQNSPLPQDTPVG
AALGLADEPVQAEGSGKKRGRPKKSGILGAGLTKRGRPPGSGKKPGRPPKATTTDVSASAGPKRRPGRPPKNQSQPTLIP
FAPAVSAASVDTEHVAASAETAPVDADAALGPRARGRPKKYADEMIAAGRGRGRGRGRGGGGRGRGRGRGELPAQPRKPG
ARPVGRPKKGSTSASTSQNAANEDLRRKLEHFQSKVKESLAVLKPHFNHESPVTAIAAIQELEVLGTMDLNVPLRDETLP
HQVELPPPQPPVQQQQQPPQQQLQQPPQQPPQQHLAPQQLPPQPPIFQQTYPPFHLPQFHHHQPSLQFQQQQQQPPQPPP
QLFQHQAQPPSHQQFHP*

DNA
ATGGAGCCTTCCTCGATCTCTCCACCGCCAGCTCCGCCTGCCACCGCCGTCCCCTTCCCCGCCGAACCCAACGACCACCT
TCCACCACCCATTCCCGAACCACCTTCTAACCACCCACCCTACGCCGAGATGATATACACGGCAATCGAGGCGCTGAAGG
AGAAAGACGGTTCTAGCAAGAGGGCAATAGCGAAGTATATTGAGCAAGTGTATACGCAGCTTCCACCGAATCACTCAGAC
TTGTTGACTCAGCACTTGAATCACTTGAAGAGTAGGGGATTGCTCCAAATGGTAAAAAAATCTTACGCCCTTCCTAGATC
TGTGCCCGTGTCTGTTCCTGGACCTGCACCCACACAAGGGACATCAGCAGTGCCGGCTGCTGTTGTTGCCATCACGACGA
CTCCGAGGCCCAGAGGTCGGCCTCGCAAGGCCCAAAATCCAGTTCAGAACTCGCCGCTGCCTCAGGACACTCCGGTCGGG
GCTGCGCTTGGGCTTGCAGACGAGCCCGTGCAAGCGGAAGGCAGTGGCAAGAAGCGAGGTCGTCCGAAGAAGAGTGGCAT
CTTAGGAGCGGGCCTGACCAAGAGGGGCCGTCCTCCCGGCTCTGGAAAAAAGCCGGGCCGTCCTCCCAAGGCAACCACAA
CAGATGTTTCTGCTTCTGCTGGGCCCAAGAGACGTCCAGGCCGCCCGCCCAAGAATCAGTCGCAGCCCACTCTCATTCCC
TTTGCTCCGGCTGTATCTGCCGCTTCCGTGGATACAGAGCACGTGGCAGCATCAGCTGAAACTGCGCCGGTTGATGCTGA
CGCGGCTCTCGGACCAAGAGCCCGTGGACGGCCGAAGAAATATGCTGACGAGATGATTGCTGCGGGCCGAGGCAGGGGAC
GGGGCCGTGGGCGCGGTGGCGGCGGAAGAGGACGAGGGAGAGGGCGTGGTGAATTGCCTGCACAGCCCAGAAAACCAGGG
GCAAGGCCCGTGGGTCGTCCGAAAAAGGGTTCAACTTCTGCTAGTACTTCTCAAAATGCTGCAAATGAAGATCTCAGGAG
GAAGCTTGAACACTTTCAATCAAAAGTCAAGGAATCTCTTGCAGTGCTTAAGCCTCATTTTAACCATGAAAGTCCAGTCA
CTGCAATTGCTGCTATTCAAGAGCTAGAAGTACTGGGAACTATGGACCTCAATGTACCACTAAGGGATGAAACACTTCCA
CATCAAGTGGAGCTGCCACCACCACAGCCACCAGTGCAGCAGCAGCAGCAGCCACCACAGCAGCAGCTGCAGCAGCCACC
CCAGCAGCCACCACAGCAACACCTAGCACCACAACAACTGCCGCCACAGCCACCGATATTTCAGCAAACATATCCTCCAT
TTCATCTGCCGCAGTTCCACCATCACCAGCCTTCGCTGCAGTTCCAGCAACAGCAGCAGCAGCCGCCACAGCCACCGCCA
CAGCTATTCCAGCACCAGGCACAGCCTCCTTCCCACCAACAGTTTCATCCTTAG