Details for Soybean Locus Glyma.09G174700

Position : Chr09 ( 5`- 39914945 .. 39916363 -3` )
Annotation :
External links : CoGe
PGDD synteny : Glyma.09G174700

Protein [Map View]
MLDPASELVPPPSSPTISSISSSDLDTESTGSFFHDRSTTLGTLMGVNFPTIAFRVPSQHRNPNSAAEDTGGARRAAAAV
KKKKKATSIATVAERRRRWWQLCRDGDARPASLGEFLEVERRFGDGAFYGTAAELEGVVAGHQQRNGSRVLFADGRVLPP
PEDVDDRAPPTESLCNRFPVSLAGICSGGAA*

DNA
ATGCTAGATCCAGCCTCTGAATTGGTGCCACCACCATCTTCACCCACAATTTCTTCCATTTCTTCCTCTGATCTTGACAC
TGAGTCCACCGGATCATTCTTCCATGACAGAAGCACCACATTGGGGACACTAATGGGAGTGAACTTCCCAACCATTGCAT
TCAGAGTCCCATCGCAGCACCGGAACCCTAATTCCGCCGCCGAGGACACCGGCGGCGCAAGGAGGGCCGCCGCCGCAGTC
AAAAAGAAGAAAAAGGCTACCTCCATCGCGACGGTGGCGGAGAGGCGGCGGAGGTGGTGGCAGCTCTGCCGCGACGGCGA
CGCCAGGCCAGCGTCTCTCGGGGAGTTTCTGGAGGTGGAGCGGAGGTTCGGCGACGGCGCGTTCTACGGCACGGCGGCGG
AGCTCGAGGGAGTGGTCGCCGGCCACCAGCAGAGGAACGGCAGCAGGGTGCTCTTCGCCGACGGGAGGGTTCTTCCGCCG
CCGGAAGACGTCGACGATCGAGCACCGCCGACGGAGAGCCTCTGTAATCGGTTTCCGGTTTCGCTTGCCGGAATTTGTAG
CGGCGGTGCGGCGTAG