Details for Soybean Locus Glyma.09G174400

Position : Chr09 ( 5`- 39897429 .. 39901815 -3` )
Annotation :
External links : CoGe
PGDD synteny : Glyma.09G174400

Protein [Map View]
MLTHLSRTPAACGGATSKHFLVLRQFSSAAGAAVSSVSDSDPTLPSSSESQRKASRWLLFLPGAITFGLGTWQIIRREEK
IKMLEYRENRLQMEPLKFSSAYSSNEELDSLEFRKVVCKGYFDDKKSIYVGPRSRSISGITENGYYIITPLMPVPNCPDS
VSFPILVNRGWVPRSWKDKFLEASEDEDLEDALPSPSHDDGTKSWWRFWSRKPVIEDQVASVTPIEVVGVVRESEKPSIF
VPANDPKASQWFYVDVPGIARACGLPENTIYVEDINEDVNPSNPYPVPKDVNTLIRSSVMPRDHLNYTLTWCSLSAAVTF
MAFKRLRQKNKWR*

DNA
ATGCTAACTCATCTCAGCCGCACCCCCGCCGCATGCGGTGGTGCCACCTCCAAACATTTCCTCGTCCTCAGGCAGTTCAG
CTCCGCCGCCGGCGCCGCCGTTTCCTCTGTGTCTGATTCCGACCCAACACTTCCCTCTTCTTCCGAATCACAGAGAAAAG
CATCTAGATGGTTGCTGTTTCTACCTGGGGCAATCACATTTGGCCTCGGGACTTGGCAGATTATTAGAAGAGAAGAAAAG
ATTAAAATGTTGGAATATCGAGAGAACAGGTTGCAAATGGAACCATTAAAATTCAGTAGTGCTTATTCATCAAATGAGGA
ATTAGATTCTCTGGAATTTAGGAAGGTGGTGTGCAAAGGATATTTTGATGATAAAAAATCAATCTATGTGGGACCACGTT
CAAGAAGTATTTCAGGAATCACTGAAAATGGTTACTATATCATAACACCTCTTATGCCAGTTCCCAATTGTCCTGACAGT
GTGAGTTTTCCAATTTTAGTCAACAGAGGGTGGGTTCCACGTAGTTGGAAAGACAAATTTTTAGAGGCTTCAGAAGATGA
AGATTTGGAAGATGCTCTTCCTTCCCCTTCTCACGATGATGGAACTAAATCTTGGTGGAGATTTTGGTCTAGAAAGCCTG
TTATTGAGGATCAGGTTGCATCTGTTACACCTATAGAAGTTGTTGGCGTAGTTCGTGAAAGTGAGAAGCCAAGCATATTT
GTTCCGGCAAATGATCCCAAGGCTTCCCAGTGGTTCTATGTTGATGTTCCAGGCATTGCTCGTGCTTGCGGCCTTCCAGA
AAATACCATCTATGTTGAAGATATTAACGAAGATGTGAATCCAAGTAATCCTTACCCTGTGCCCAAGGATGTGAATACCT
TGATTCGAAGTTCAGTCATGCCTAGGGACCACCTAAACTATACATTGACATGGTGTTCTCTTTCTGCAGCAGTTACATTT
ATGGCTTTTAAGAGGCTTAGACAGAAAAATAAGTGGAGATAG