Details for Soybean Locus Glyma.09G174200

Position : Chr09 ( 5`- 39883774 .. 39890294 -3` )
Annotation :
External links : CoGe
PGDD synteny : Glyma.09G174200

Protein [Map View]
MEREFFGLSSKNGAWTTMKDDAVNKSRDQVRSSGMQWSFPNKVSALPQFLSFKTNQEDKPRKTILEPLASSGYMAMSTQY
AFDSNQKSFLGLTNRNLSISKHAAGNKQGMTVYPLQCCDAQSEEARIFSVSNQSNQVSPVLQSNLASTGLNMVNSVIKPQ
PFGSKSSGTPLSILPSIGSIVGSTDLRNNSKSSTMPTQLTIFYAGSVCVYDDISPEKAKAIMLMAGNGYTPTEKMELPTV
KLQPAISIPSKDDGFMISQSYPPSTFPTPLPLTSHVNSQPGGGSSSNKEISIIRQVGPSTAPTNHLESPIIGSIGSASKE
KAQPVCLPQARKASLARFLEKRKGRMMRTSPYLYMSKKSPECSSSGSDSVSFSLNFSGSCSLPATN*

DNA
ATGGAGAGGGAATTTTTTGGCTTGAGTTCCAAAAATGGTGCATGGACTACTATGAAAGATGATGCTGTCAACAAATCAAG
AGACCAAGTGAGGAGTTCAGGAATGCAGTGGTCATTCCCAAACAAGGTCTCTGCCCTTCCTCAATTCCTGTCTTTCAAGA
CCAATCAGGAAGACAAGCCTAGAAAGACTATTCTTGAGCCACTAGCTTCATCTGGATATATGGCCATGTCAACTCAATAT
GCTTTTGACTCTAACCAAAAATCATTCTTGGGTTTGACCAACAGAAATTTGTCCATAAGCAAGCATGCTGCAGGGAACAA
ACAAGGAATGACAGTTTATCCTCTACAATGTTGTGATGCACAGTCAGAGGAAGCAAGAATATTTTCAGTGTCCAACCAAT
CAAATCAAGTGAGTCCTGTTCTTCAATCTAATCTTGCCTCTACCGGACTGAACATGGTCAATTCAGTCATAAAACCACAA
CCTTTTGGTTCCAAATCCTCTGGCACACCTCTATCTATTCTTCCATCAATAGGTTCCATTGTTGGATCTACTGACTTAAG
GAATAATTCCAAATCCTCCACCATGCCTACTCAGCTCACGATTTTCTATGCTGGTTCTGTGTGTGTTTATGATGACATTT
CTCCAGAGAAGGCCAAGGCTATCATGTTAATGGCTGGGAATGGTTATACTCCAACTGAGAAAATGGAACTTCCCACAGTG
AAATTACAGCCAGCAATTTCTATTCCCTCCAAAGATGATGGTTTCATGATAAGCCAATCCTATCCACCCTCAACCTTTCC
AACCCCTCTCCCATTGACCTCTCATGTCAATTCTCAGCCAGGAGGAGGATCTTCTAGCAACAAAGAAATTTCAATAATAA
GACAAGTAGGACCTTCAACTGCTCCTACTAACCATTTGGAATCACCCATTATTGGTTCTATAGGATCTGCATCTAAAGAA
AAGGCTCAGCCAGTTTGCTTGCCTCAGGCACGTAAAGCATCCTTGGCTCGGTTTTTGGAGAAGAGAAAGGGAAGGATGAT
GAGAACATCGCCATACTTATATATGAGCAAGAAATCACCTGAATGCAGCTCTTCTGGATCAGACAGTGTCAGTTTCTCCT
TGAACTTCTCTGGATCCTGTTCACTACCAGCCACCAACTAG