Details for Soybean Locus Glyma.09G174000

Position : Chr09 ( 5`- 39862952 .. 39875152 -3` )
Annotation :
External links : CoGe
PGDD synteny : Glyma.09G174000

Protein [Map View]
MVFKGRFFSSKKSDSSSPDASSNSPRSFSSNSPSRSDKKKTKSAANQTLAAAAAVGSGGGGGGLAPCRQTQVKDGTKKKD
VVKGKESQTPPPDSRKDSAAKKLMAAEGRESPSSLSVSPILASSLGLNRIKTRSGPLPQESFFGFRGEKGTAALGGSNLS
RPGVGARAGDGKKKEVANQSRVGFHEDSVGGAAATGGWGDNGSNSDSVSTSGSLPSREQSPVVLPRSRLQNGESSSEAAG
KQVSSRAQSGGLKSADICTPETAYDFENPKESESPRFQAILRVTSAPRKRFPSDIKSFSHELNSKGVWPFPFSKPRRLNN
LEEILVVIRAKFDKAKEDVNSDLAIFAADLVGILEKNADTHPDWQETIEDLLVLARSCAMTSSGEFWLQCESIVQELDDR
RQEHPPGMLKQLHTRMLFILTRCTRLLQFHKESGLAEDEPVFNLRQSRVLHSAGKFIPPSVGRDTKSSSAAKALKPSSKK
AFSQEQSMMGWKKDVMQPENLSIPADDDNAKLFDSSSGRNRMASWKKFPSPTGRSPKEAVQLKDQNYGRVESSKASNNKR
FTSDVDLSTAKPSELLPVKDSLDHASKHQHKVSWGYWGDQQNNNSEENSIICRICEEDVPTSHVEDHSRICAVADRCDQK
GLSVNERLVRISDTLEKMMESCTQKDTQQMVGSPDVAKVSNSSMTEESDVPSPKLSDWSRRGSEDMLDCFPEADNSVFMD
DLKGLPLMSCKTRFGPKSDQGMTTSSAGSMTPRSPLMTPRTSQIDLLLAGKGAYSEHDDLPQMNELADIARCVANAPLDD
DRTTSYLLSCLDDLRVVVDRRKFDALTVETFGTRIEKLIREKYLQLTEMVDVEKIDTESTVDDDILEDDVVRSLRTSPIH
SSRDRTSIDDFEIIKPISRGAFGRVFLAKKRTTGDLFAIKVLKKADMIRKNAVESILAERDILITVRNPFVVRFFYSFTC
RENLYLVMEYLNGGDLYSLLRNLGCLDEEVARVYIAEVVLALEYLHSLRVVHRDLKPDNLLIAHDGHIKLTDFGLSKVGL
INSTDDLSGPAVNGTSLLEEDETDVFTSADQRERREKRSAVGTPDYLAPEILLGTGHGFTADWWSVGVILFELLVGIPPF
NAEHPQIIFDNILNRKIPWPAVPEEMSPEALDLIDRLLTEDPNQRLGSKGASEVKQHVFFKDINWDTLARQKAAFVPASE
SALDTSYFTSRYSWNTSDGFVYPASDVEDSSDADSLSGSSSCLSNRQDEVGDECGGLTEFDSGTSVNYSFSNFSFKNLSQ
LASINYDLTKGWKDDPATNSSA*

DNA
ATGGTCTTCAAGGGAAGGTTCTTCTCTTCCAAGAAATCCGATTCTTCTAGCCCCGATGCGTCCTCCAATAGTCCTCGATC
TTTCTCCTCCAATTCCCCTTCCAGATCCGACAAGAAAAAAACTAAATCCGCCGCGAATCAAACCCTAGCCGCCGCTGCCG
CCGTCGGCAGCGGCGGCGGCGGCGGCGGTCTCGCTCCGTGCCGGCAGACGCAGGTCAAGGATGGAACTAAGAAGAAGGAT
GTGGTCAAGGGGAAAGAAAGTCAAACGCCGCCGCCGGATTCTCGAAAGGATTCTGCGGCGAAGAAGTTGATGGCGGCGGA
GGGACGGGAGTCGCCGTCGTCGTTGTCGGTGTCGCCGATTCTGGCGTCGTCGCTGGGGCTGAACAGGATCAAGACGAGAT
CGGGGCCGCTGCCGCAGGAGAGCTTCTTCGGATTCAGGGGCGAGAAAGGGACGGCGGCGCTCGGCGGCAGCAACCTCTCC
CGGCCGGGTGTCGGTGCCCGCGCCGGCGATGGGAAGAAGAAGGAGGTGGCGAACCAGAGCAGGGTGGGGTTTCATGAGGA
TTCCGTCGGCGGTGCCGCCGCCACCGGAGGTTGGGGCGATAACGGGAGCAATTCCGATAGCGTTTCGACGTCGGGGAGCT
TGCCGTCGCGGGAGCAGAGTCCGGTCGTGTTGCCGCGGTCGCGGTTGCAGAACGGAGAATCATCATCGGAAGCTGCAGGC
AAACAGGTATCATCACGGGCTCAGTCTGGAGGCTTAAAAAGTGCAGATATTTGTACTCCAGAGACAGCATATGATTTTGA
AAACCCAAAGGAGTCTGAATCTCCTCGTTTTCAAGCTATATTACGCGTCACTAGTGCACCCAGAAAGAGGTTTCCTTCAG
ATATCAAAAGTTTTTCCCACGAGCTGAATTCGAAAGGTGTCTGGCCTTTTCCATTTTCGAAGCCTCGGCGGTTAAATAAC
CTTGAGGAGATTTTGGTTGTTATTAGAGCAAAATTTGATAAAGCAAAGGAAGACGTGAACTCTGATCTGGCTATTTTTGC
GGCAGACCTGGTTGGAATTCTTGAAAAAAATGCAGATACTCATCCTGATTGGCAAGAGACCATTGAGGACTTGCTAGTTT
TGGCCAGGAGCTGTGCTATGACTTCATCCGGTGAGTTTTGGCTTCAGTGTGAAAGCATAGTTCAGGAGTTGGATGATAGG
CGTCAAGAGCATCCTCCAGGGATGCTAAAGCAGCTTCACACTCGAATGCTTTTCATTCTCACAAGGTGTACCCGATTATT
GCAATTCCATAAGGAAAGTGGTTTGGCTGAGGATGAACCTGTTTTCAATCTCCGTCAATCCAGAGTCTTGCATTCTGCTG
GAAAATTTATTCCTCCTAGTGTGGGAAGGGATACTAAAAGTTCAAGTGCTGCAAAGGCCTTAAAGCCTTCATCGAAAAAA
GCTTTTAGTCAAGAGCAGAGTATGATGGGTTGGAAGAAAGATGTTATGCAACCAGAAAATTTATCTATTCCTGCTGATGA
TGACAATGCAAAACTCTTTGACTCTTCTTCAGGCAGGAATCGAATGGCTTCTTGGAAGAAATTCCCTTCTCCAACAGGAA
GAAGCCCTAAAGAAGCTGTTCAGTTGAAGGACCAAAATTATGGGAGGGTTGAATCTTCAAAGGCATCAAATAATAAGAGA
TTCACTTCCGATGTGGATCTCTCTACTGCTAAGCCATCTGAGCTTCTTCCTGTCAAAGATTCCTTGGATCATGCTTCCAA
ACACCAACACAAAGTTTCCTGGGGATACTGGGGAGATCAGCAGAATAATAATAGCGAGGAGAATTCAATAATCTGTCGTA
TATGTGAAGAGGATGTTCCTACTTCACATGTTGAAGATCATTCAAGGATTTGTGCAGTTGCTGATAGATGTGATCAGAAG
GGACTGAGTGTCAATGAGCGTCTTGTCAGAATTTCTGATACACTAGAAAAGATGATGGAATCATGCACACAAAAGGATAC
CCAACAAATGGTGGGAAGTCCCGATGTTGCAAAAGTGTCAAATTCTAGTATGACTGAAGAATCTGATGTTCCTTCACCTA
AACTTAGTGATTGGTCTCGCAGAGGCTCAGAGGACATGCTTGACTGTTTCCCTGAAGCCGACAATTCTGTTTTTATGGAT
GACCTAAAAGGATTACCACTTATGTCATGTAAAACTCGTTTTGGTCCAAAGTCTGACCAAGGTATGACAACATCCTCTGC
AGGGAGCATGACTCCCAGGTCTCCATTGATGACACCACGGACAAGTCAGATTGACTTGCTCTTGGCAGGGAAGGGTGCTT
ATTCTGAACATGATGATCTGCCGCAGATGAATGAACTTGCTGACATTGCGCGCTGTGTGGCAAATGCACCTTTGGATGAT
GATCGCACGACGTCATATTTATTATCTTGTCTTGATGATTTGCGGGTTGTTGTAGATAGAAGGAAATTTGATGCACTTAC
TGTGGAGACCTTTGGAACACGTATTGAGAAGCTGATTCGAGAGAAGTATCTGCAGCTCACTGAGATGGTGGATGTTGAAA
AGATAGATACAGAGAGCACTGTTGATGATGATATCTTGGAAGATGATGTGGTTCGCAGCTTGAGAACAAGCCCAATCCAT
TCTTCAAGGGATCGCACCTCTATTGATGACTTTGAGATTATAAAACCTATCAGTCGTGGGGCATTTGGAAGGGTTTTCTT
GGCTAAAAAGAGAACAACTGGTGATCTTTTTGCAATAAAGGTTCTCAAGAAGGCAGATATGATCCGTAAGAATGCTGTGG
AAAGTATATTAGCAGAACGTGATATCTTAATTACAGTACGCAACCCTTTTGTGGTTCGATTCTTCTATTCTTTTACATGT
CGCGAGAACTTATATCTTGTCATGGAATATCTTAATGGAGGTGACCTGTATTCATTATTAAGGAATTTAGGTTGCTTAGA
TGAGGAAGTCGCCCGTGTATATATTGCTGAAGTGGTGCTTGCATTAGAGTATTTGCATTCACTGCGTGTGGTTCATCGTG
ACTTGAAGCCCGACAATTTATTGATAGCACATGATGGTCACATCAAGTTAACAGACTTTGGGCTTTCTAAAGTTGGTCTC
ATCAACAGCACAGATGATCTGTCTGGTCCAGCAGTGAATGGGACATCACTACTTGAAGAAGATGAAACTGATGTATTTAC
ATCCGCGGATCAAAGGGAAAGGAGGGAGAAACGTTCTGCAGTGGGCACACCTGATTACTTAGCCCCAGAGATACTTTTGG
GAACTGGACATGGGTTTACTGCCGATTGGTGGTCTGTTGGGGTCATTTTATTTGAGTTGCTTGTTGGTATTCCACCCTTC
AATGCAGAGCACCCTCAGATTATATTTGATAATATTCTTAATCGTAAGATACCTTGGCCAGCAGTTCCTGAAGAGATGAG
TCCTGAAGCACTGGATCTTATTGATCGATTATTGACAGAAGATCCTAATCAAAGACTAGGATCCAAAGGGGCATCAGAGG
TAAAGCAACATGTTTTCTTCAAGGATATAAACTGGGACACACTTGCCAGGCAGAAAGCTGCATTTGTTCCTGCTTCTGAG
AGTGCTCTAGATACCAGTTACTTCACTAGTCGCTACTCATGGAATACTTCTGATGGTTTTGTATATCCAGCAAGTGATGT
TGAGGATTCTAGTGATGCTGATAGCTTAAGTGGCAGCAGTAGTTGTTTGAGCAATCGACAAGATGAAGTGGGAGATGAAT
GTGGGGGTCTTACCGAGTTTGATTCTGGCACATCTGTCAATTACTCTTTTAGTAATTTCTCCTTTAAGAATCTCTCCCAG
CTTGCATCAATCAACTATGATCTCACCAAGGGATGGAAAGATGACCCGGCAACGAACTCTAGTGCATAG