Details for Soybean Locus Glyma.09G172700

Position : Chr09 ( 5`- 39731937 .. 39735690 -3` )
Annotation :
External links : CoGe
PGDD synteny : Glyma.09G172700

Protein [Map View]
MASLSMTQIRTGNCASGFGLNCAGKVKVGPSRVGFKVFASETQATEPDLSVTVNGLHMPNPFVIGSGPPGTNYTVMKRAF
DEGWGAVIAKTVSLDAAKVINVTPRYARLRAGADRSAKGEIIGWENIELISDRPLEIMLKEFKQLKEEYPDRILIASIME
EYNKAAWEELIDRVEQTGVDAFEINFSCPHGMPERKMGAAVGQDCALLEEVCGWINAKATIPVWAKMTPNITDISQPARV
ALSSGCEGVSAINTIMSVMGINLDTLRPEPCVEGYSTPGGYSAKAVHPIALGKVMSIAKMMKSEFDSENYTLSAIGGVET
GGDAAEFILLGANTVQVCTGVMMHGYGLVKKLCLELQDFMKKHNFTSIEDFRGVSLEYFTTHTDLVRRQKEAVQKRKAIK
KGLQSDKDWTGDGFVQETESMVSN*

DNA
ATGGCATCTTTGAGCATGACCCAGATCAGAACTGGGAATTGTGCATCTGGGTTTGGCTTGAATTGTGCTGGGAAGGTTAA
GGTTGGTCCCAGCAGAGTTGGGTTTAAGGTGTTTGCTTCAGAGACTCAGGCTACAGAGCCTGATCTTAGTGTCACTGTTA
ATGGGTTGCACATGCCTAACCCCTTTGTTATTGGGTCAGGTCCACCAGGGACCAATTACACTGTCATGAAGAGGGCATTT
GATGAAGGTTGGGGTGCTGTGATTGCTAAAACTGTATCACTTGATGCTGCAAAAGTTATAAATGTAACTCCTCGATATGC
CCGGCTACGGGCAGGTGCAGATAGATCTGCAAAAGGAGAAATTATTGGGTGGGAGAACATAGAACTTATCAGTGATAGGC
CACTTGAAATTATGTTGAAAGAATTCAAGCAATTAAAAGAAGAGTATCCGGACAGAATTCTCATTGCTTCAATCATGGAG
GAGTACAATAAGGCTGCTTGGGAGGAGCTTATTGATAGAGTCGAGCAAACTGGAGTTGATGCATTTGAAATAAATTTCTC
ATGTCCTCACGGTATGCCAGAACGCAAAATGGGTGCTGCTGTTGGGCAAGATTGTGCTCTTCTGGAAGAGGTTTGTGGAT
GGATAAATGCTAAAGCCACAATTCCTGTTTGGGCTAAGATGACTCCCAACATAACTGATATTTCACAGCCAGCAAGGGTT
GCTCTAAGTTCAGGATGTGAGGGAGTTTCTGCCATAAATACAATCATGAGTGTCATGGGAATCAACCTCGATACACTACG
TCCTGAGCCTTGTGTTGAGGGGTACTCAACTCCTGGGGGTTATTCTGCAAAGGCAGTCCATCCCATAGCACTTGGGAAGG
TGATGAGCATTGCAAAGATGATGAAGTCAGAGTTTGATAGTGAGAACTATACACTTTCTGCCATTGGTGGCGTTGAGACA
GGTGGTGATGCTGCTGAGTTTATCCTTCTCGGGGCAAACACTGTTCAGGTGTGCACTGGGGTTATGATGCATGGCTATGG
TCTTGTGAAGAAACTATGTCTTGAGCTTCAAGACTTTATGAAAAAGCACAATTTCACATCCATAGAAGATTTCAGAGGGG
TTTCTCTTGAGTACTTTACTACTCACACTGACTTGGTAAGAAGGCAGAAGGAAGCAGTTCAGAAGAGGAAAGCCATAAAG
AAAGGGTTGCAGTCAGACAAAGACTGGACAGGAGATGGTTTTGTGCAAGAAACTGAAAGCATGGTTTCAAACTGA