Details for Soybean Locus Glyma.09G171900

Position : Chr09 ( 5`- 39656849 .. 39660683 -3` )
Annotation :
External links : CoGe
PGDD synteny : Glyma.09G171900

Protein [Map View]
MEAAATATATVLTPPSAPPRPSAFLGRPSALAFRSNLRFSTKLSTSVSFSKQGHARHRVGSKRGFVVRAASFTPESSEPT
SKIAPLKLESPIGQFLSQILISHPHLVPAAVEQQLEQFQTDCDGDKQKKEPSASGTDLVLYRRIAEVKAKERRTALEEIL
YALVVQKFMDANISLIPSLTPNHSGQVDSWPSEDGKLEELHSPEAYEMIQNHLALILGNRLGDSTSVAQISKIRVGQVYA
ASIMYGYFLKWVVQRFQLEKTMKILPNGAEENSIQHTVVDDSRISGGDGRSHVMSHPEVSTLPGGGISSGGFGYGSKVSR
LRTYVMSFDSETLQRYATIRSKEALSIIEKHTEALFGRPEIVVTPEGVIDSLTDESIKISFSGLKRLVLEAITFGSFLWD
VESYVDSRYHFVLN*

DNA
ATGGAAGCGGCGGCGACGGCAACGGCGACTGTTCTCACACCCCCGTCGGCTCCGCCCAGGCCGTCGGCTTTCCTCGGAAG
ACCCTCCGCACTCGCCTTCCGTTCCAATCTTCGCTTCTCCACTAAGTTGAGCACTTCAGTGTCGTTCTCCAAGCAAGGTC
ACGCGAGACACAGAGTTGGAAGTAAAAGGGGTTTTGTAGTTAGAGCTGCATCATTTACACCAGAGTCATCTGAACCAACT
TCCAAGATTGCTCCACTTAAGCTGGAGTCTCCAATCGGGCAGTTTCTCTCTCAGATTTTGATAAGTCACCCGCATCTTGT
GCCTGCCGCAGTAGAGCAGCAACTTGAGCAATTCCAAACTGATTGTGATGGCGATAAACAAAAGAAAGAGCCTTCTGCTT
CAGGCACTGACTTAGTTTTATACAGGAGAATTGCTGAGGTTAAGGCTAAAGAGAGGAGAACAGCTCTAGAAGAGATATTG
TATGCATTGGTGGTGCAAAAGTTCATGGATGCCAATATTTCTCTGATACCCTCCTTAACTCCAAACCACTCTGGTCAGGT
TGATTCATGGCCAAGTGAAGATGGAAAACTGGAGGAGCTTCACTCACCGGAAGCCTATGAGATGATCCAAAACCACTTGG
CTCTCATTTTGGGCAACCGTTTAGGGGATTCAACATCTGTTGCTCAGATCAGCAAAATCAGAGTAGGACAGGTCTATGCA
GCTTCGATAATGTACGGGTACTTTCTCAAGTGGGTTGTCCAAAGGTTCCAGCTGGAGAAGACAATGAAGATTCTTCCTAA
TGGAGCAGAAGAGAATAGCATTCAACATACTGTTGTAGATGATTCAAGAATCAGTGGTGGAGATGGCCGTTCTCATGTTA
TGTCCCATCCTGAAGTTTCTACTTTGCCTGGTGGTGGCATCAGCTCAGGGGGATTTGGTTATGGTTCAAAAGTGTCCAGG
TTGCGTACCTATGTGATGTCCTTTGATAGCGAGACATTACAGAGATATGCAACAATAAGATCCAAAGAGGCTCTCAGCAT
CATTGAGAAGCACACCGAAGCATTGTTTGGAAGACCTGAAATTGTTGTAACACCGGAGGGGGTAATTGATTCTTTGACGG
ATGAGAGCATCAAAATTAGCTTTAGTGGTTTGAAGAGACTTGTTTTAGAAGCTATTACTTTTGGTTCCTTTCTCTGGGAT
GTTGAGAGCTACGTCGACTCAAGGTACCATTTTGTCCTCAACTGA