Details for Soybean Locus Glyma.09G170600

Position : Chr09 ( 5`- 39553322 .. 39561659 -3` )
Annotation :
External links : CoGe
PGDD synteny : Glyma.09G170600

Protein [Map View]
MISCSSSCFSSKITIQCENVVTEFIEGLVETYPGLQYLDGFPQVKVVLRADVSAATYDKVAIISGGGSGHEPAHAGFVGE
GMLTAAICGDIFSSPPVDSILAGIRAVTGPKGCLLVVKNYTGDRLNFGLAAEIAKSEGYKVETVIVGDDCALPPPRGIAG
RRGLAGTILVHKVAGAAAAGGLSLADVAAEAKHASEIVGTMGVALTVCTIPGQVASDRLGPGKMELGLGIHGEPGAAVAD
IQPVNVVVSHVLQQILSTETNYVPITRGERVVLMVNGLGGTPTMELMITAGKTVPKLQLEHGLAVDRVYTGSFMTSLDMA
GFSISIMKADPVILQRLDAPTKAPYWPVAADGNHPPAKIPVPIPASRTAKTDEPRSRPQQLNEQGQILEVAIEAAANAII
NLKDNLNEWDGKVGDGDCGSTMYRGAKAILEDIKDYPLNDASETVGEIGSSIGRSMGGTSGIIYTIFFKAAHSVLKASSH
SGVTSKQWAEALATSIAAVSKYGGASAGYRTLLDALIPASSVLEEKLNSGDDPCTAFVLSSEAALAGAQSTVDMQAQAGR
STYISGEILSTIPDPGAMAAATWYRAAALAVKAKYQS*

DNA
ATGATTTCCTGTTCATCTAGCTGTTTTAGTTCGAAGATTACGATTCAATGTGAGAATGTTGTGACTGAATTCATTGAAGG
TCTTGTGGAGACATATCCTGGACTACAGTATTTAGATGGCTTTCCTCAGGTGAAGGTTGTCCTACGTGCAGATGTTTCAG
CTGCAACATATGATAAAGTTGCAATCATATCAGGGGGAGGAAGTGGCCATGAGCCTGCCCATGCTGGATTTGTGGGAGAA
GGAATGCTTACCGCAGCAATTTGTGGAGATATATTTTCTTCTCCACCTGTCGACTCAATTCTAGCTGGGATACGAGCTGT
GACTGGTCCTAAGGGATGTCTTCTGGTTGTAAAGAACTATACTGGTGATCGTTTGAACTTTGGCTTGGCTGCTGAGATAG
CAAAATCTGAAGGGTATAAAGTAGAGACTGTTATTGTTGGTGACGATTGTGCACTACCTCCACCTCGAGGGATTGCTGGA
AGAAGAGGTTTGGCAGGAACTATTCTGGTTCACAAGGTTGCAGGAGCTGCTGCTGCTGGTGGTCTTTCTCTTGCTGATGT
TGCTGCAGAAGCTAAACATGCATCTGAAATAGTGGGAACAATGGGTGTTGCTCTGACTGTGTGCACAATTCCTGGTCAAG
TTGCATCAGATCGTTTGGGACCAGGAAAGATGGAACTTGGTCTTGGAATTCATGGAGAACCTGGGGCAGCTGTGGCTGAT
ATTCAGCCCGTAAATGTGGTGGTTTCTCATGTTCTGCAGCAAATTTTGTCCACGGAAACAAACTATGTTCCGATAACTCG
AGGAGAAAGAGTGGTCCTTATGGTCAATGGGTTGGGTGGCACTCCTACAATGGAACTAATGATTACAGCTGGAAAAACAG
TTCCAAAGTTACAGCTAGAACATGGATTGGCTGTTGATAGAGTTTATACAGGGTCATTTATGACTTCTCTTGATATGGCA
GGTTTCTCAATTTCTATTATGAAGGCTGATCCAGTTATTCTTCAACGATTAGATGCTCCAACTAAAGCTCCTTATTGGCC
CGTTGCTGCTGATGGTAATCACCCGCCTGCTAAGATTCCTGTTCCAATCCCAGCATCTCGAACAGCAAAGACTGATGAGC
CACGAAGTCGGCCACAACAACTAAATGAGCAAGGCCAAATTCTTGAGGTAGCCATTGAAGCTGCTGCAAATGCAATTATA
AATCTGAAGGACAATCTAAATGAATGGGATGGTAAAGTTGGTGATGGCGACTGTGGATCAACTATGTATAGAGGTGCAAA
AGCAATTCTTGAGGACATCAAAGATTACCCTCTAAATGATGCTTCAGAAACTGTCGGCGAAATTGGTTCATCAATTGGAA
GATCCATGGGAGGAACAAGTGGGATTATATATACAATATTTTTTAAGGCAGCACATTCAGTGCTAAAAGCAAGCTCCCAT
TCTGGTGTCACATCAAAACAATGGGCTGAAGCACTCGCAACTTCCATTGCTGCTGTAAGTAAATATGGGGGCGCTAGTGC
TGGTTATAGAACATTGTTAGATGCCCTTATTCCAGCATCGTCGGTTCTTGAAGAGAAATTAAATTCTGGAGATGATCCTT
GCACCGCTTTTGTTCTCTCCTCTGAAGCTGCATTGGCTGGAGCTCAGTCAACGGTAGACATGCAAGCACAGGCTGGACGT
TCGACTTACATTTCTGGAGAGATTCTTTCGACAATTCCTGATCCTGGTGCTATGGCTGCAGCGACATGGTACAGAGCCGC
GGCCTTAGCTGTGAAGGCCAAATACCAGAGCTAA