Details for Soybean Locus Glyma.09G168900

Position : Chr09 ( 5`- 39359163 .. 39363819 -3` )
Annotation :
External links : CoGe
PGDD synteny : Glyma.09G168900

Protein [Map View]
MVLTSTATHPDEKDQSLNSTFASRYVRDPIPKFKMPEKSIPKDAAFQIINDELMLDGAPRLNLASFVTTWMEPECDKLIM
ASLNKNYVDMDEYPVTTELQNRCVNIIANLFHAPISEEETAVGVGTVGSSEAIMLAGLAFKRKWQTKRKAEGKPYDKPNI
VTGANVQVCWEKFARYFEVELKEVKLKEGYYVMDPAKAVEMVDENTICVAAILGSTMTGEFEDVKLLNELLTEKNKETGW
DTPIHVDAASGGFIAPFLYPDLEWDFRLPLVKSINVSGHKYGLVYPGVGWVVWRSKDDLPDELVFHINYLGSDQPTFTLN
FSKGSSQIIAQYYQLIRLGFEGYKNIMENCLENARVLKEGIERTGRFNIISKDIGVPLVAFSLKDSSQHTVFEIADHLRK
FGWIVPAYTMPPDAQHIAVLRVVIREDFSRGLAERLAADIEKVVKLLDTLPSPLTTKVAHITAITSETSEKVKSAIETQK
EIALYWKRLVDGKRLGAC*

DNA
ATGGTTCTCACATCCACTGCCACTCACCCAGATGAAAAAGACCAGAGCCTAAACTCTACTTTTGCTTCCAGATATGTGCG
TGATCCTATTCCAAAATTCAAGATGCCAGAGAAATCAATACCAAAGGATGCAGCTTTTCAGATAATAAACGATGAGTTGA
TGTTGGATGGTGCACCAAGGCTCAACTTGGCTTCGTTTGTGACCACTTGGATGGAGCCTGAGTGTGACAAGCTCATAATG
GCTTCACTTAACAAAAACTATGTTGATATGGATGAGTATCCTGTCACCACTGAGCTCCAGAACCGTTGTGTTAATATAAT
AGCAAATCTATTCCATGCTCCTATAAGTGAAGAGGAGACTGCAGTAGGTGTGGGAACTGTGGGGTCATCAGAGGCAATAA
TGTTGGCAGGTCTTGCTTTTAAAAGGAAATGGCAGACAAAGAGAAAAGCAGAAGGCAAACCATATGATAAGCCCAATATA
GTTACTGGGGCTAATGTGCAGGTTTGTTGGGAAAAATTTGCAAGGTACTTTGAGGTAGAGCTCAAGGAAGTGAAACTCAA
AGAGGGATACTATGTGATGGACCCTGCGAAAGCTGTTGAAATGGTAGATGAGAACACCATCTGTGTTGCAGCCATTTTGG
GATCAACTATGACTGGAGAGTTTGAGGATGTGAAGCTTCTCAATGAACTTCTCACTGAAAAGAACAAGGAGACAGGTTGG
GATACCCCAATTCATGTAGATGCTGCCAGTGGGGGGTTTATTGCCCCATTTCTATATCCTGATTTAGAGTGGGACTTCCG
TTTGCCGTTGGTGAAAAGCATCAATGTTAGTGGCCACAAGTATGGTCTTGTCTACCCTGGTGTTGGTTGGGTTGTCTGGA
GGAGCAAAGATGACTTGCCAGATGAACTTGTTTTTCACATAAATTATCTTGGATCTGATCAGCCCACTTTCACATTGAAT
TTCTCCAAAGGATCTAGTCAAATTATAGCTCAATATTATCAATTGATTCGGCTTGGCTTTGAGGGTTACAAAAATATCAT
GGAAAATTGCTTGGAGAATGCAAGAGTTTTGAAGGAAGGAATTGAGAGAACAGGGCGGTTTAACATCATCTCAAAGGATA
TTGGCGTGCCACTTGTAGCCTTTTCCTTGAAAGACAGTAGCCAACACACGGTGTTTGAGATAGCAGACCATCTGAGAAAA
TTCGGGTGGATAGTTCCGGCCTATACAATGCCACCGGACGCGCAACACATAGCGGTCCTCCGGGTGGTGATCAGGGAGGA
TTTCAGCCGTGGCTTGGCCGAGAGACTTGCTGCTGACATAGAGAAGGTTGTGAAGCTCTTGGACACACTTCCTAGCCCCC
TCACTACCAAAGTTGCTCATATCACAGCCATCACTAGTGAGACTAGTGAGAAGGTTAAGAGTGCAATAGAGACTCAGAAA
GAGATTGCTTTGTACTGGAAGCGACTTGTGGATGGCAAGAGACTTGGAGCATGTTAG