Details for Soybean Locus Glyma.09G166300

Position : Chr09 ( 5`- 39014889 .. 39018468 -3` )
Annotation :
External links : CoGe
PGDD synteny : Glyma.09G166300

Protein [Map View]
MERDPNMGKEKVVSNSTLLPSSTKGFKDKGIPNNSMPSWLLTNISDLEERMKVLAMSTTEDEEMGDTFADRAETYYQKRP
QLLSLLQDLYNGYITLSDRYIQTLAKHKHHSRHSSQVSTVDEGFSDQEEEASGVSHSDSDIESSISYQHPQHMMMPIGLP
KSSMLDVDAIVAELLIRNIEYDMLMHEVGVMERRYCESSRKSELQKSLLEVLESERIVLLNENASLGYRVNTLVEENKEL
ASESVFIKRKAGELAKCVLKMREDHRVYLLHRKIEDLQAQIHALEKRNKEYYDKLLRRDGHEDGKKGVALEVCVQMDKQK
RFKWKDGNTSGMKKFHGKKSPPSLWKKLKNMDLLLCGTNPTCA*

DNA
ATGGAGAGGGACCCAAACATGGGCAAGGAAAAAGTGGTTTCAAATTCCACATTGCTTCCCTCGTCCACAAAAGGGTTCAA
GGACAAGGGCATCCCCAACAATAGCATGCCCTCCTGGCTTCTCACCAACATTTCTGACTTGGAGGAGAGGATGAAAGTGT
TGGCAATGAGTACAACAGAAGATGAAGAAATGGGAGACACATTTGCTGATAGAGCAGAAACTTACTACCAAAAGAGGCCT
CAGCTACTGTCCCTTCTGCAGGACTTGTACAATGGCTACATAACCTTATCTGACCGTTACATCCAAACACTGGCCAAACA
CAAGCACCATAGTAGACACTCTTCTCAAGTTTCAACTGTAGATGAAGGCTTCTCTGACCAAGAAGAAGAAGCTAGTGGTG
TGAGCCACAGTGATTCAGACATTGAAAGCTCAATCTCCTACCAACACCCCCAACACATGATGATGCCAATAGGCCTCCCA
AAAAGCTCCATGCTTGATGTTGATGCTATTGTTGCTGAGCTTTTGATAAGGAATATTGAGTATGACATGTTGATGCATGA
AGTTGGTGTCATGGAGAGGAGGTACTGTGAGTCCTCAAGGAAAAGTGAGCTTCAAAAGAGCCTTCTTGAGGTGTTGGAGT
CTGAGAGGATTGTTCTTTTGAATGAGAATGCTAGCTTGGGCTATAGGGTCAACACTTTGGTGGAAGAAAACAAGGAGCTT
GCATCTGAGTCAGTGTTCATCAAGAGAAAAGCCGGTGAGCTTGCTAAGTGTGTGCTGAAGATGAGGGAGGATCATAGAGT
GTACTTGCTGCACAGGAAAATTGAGGATCTTCAGGCTCAGATACATGCCTTGGAGAAGAGGAACAAGGAGTACTATGATA
AGCTTCTGAGAAGAGATGGTCATGAAGATGGTAAAAAAGGTGTGGCTTTGGAGGTTTGTGTTCAGATGGACAAGCAAAAG
AGGTTCAAGTGGAAAGATGGCAACACTTCTGGGATGAAGAAATTTCATGGGAAGAAGTCCCCCCCAAGTTTGTGGAAAAA
GCTGAAGAACATGGATTTGTTGTTGTGTGGTACTAATCCAACTTGTGCTTGA