Details for Soybean Locus Glyma.09G166200

Position : Chr09 ( 5`- 39011549 .. 39013876 -3` )
Annotation :
External links : CoGe
PGDD synteny : Glyma.09G166200

Protein [Map View]
MGLQAYQCSCLIMFYLCLTNPFIFLYAKGETYIVGDSYGWDDVLDFSNWRDGKEFHVGDVLVFNYERSLHSVLQVDSTAY
ENCIKDSYTQRFTSGNDSVVLKEGRAWFICGVDDHCENGQKLHITATS*

DNA
ATGGGTCTTCAAGCTTATCAATGTTCCTGTTTAATCATGTTCTACCTTTGCCTCACGAACCCCTTCATTTTTCTCTATGC
AAAGGGAGAAACCTACATTGTTGGTGACAGTTATGGTTGGGATGACGTCTTGGATTTCAGCAACTGGCGTGATGGAAAAG
AGTTTCATGTTGGTGATGTTCTAGTGTTCAACTACGAAAGAAGCCTGCATAGTGTGTTGCAAGTTGATTCCACTGCTTAT
GAGAATTGCATAAAGGACTCGTATACACAGAGGTTCACTAGTGGCAATGACTCGGTGGTTTTAAAGGAAGGCAGAGCATG
GTTCATATGTGGAGTAGATGATCACTGTGAAAATGGGCAGAAGCTTCACATTACTGCAACTTCTTAG