Details for Soybean Locus Glyma.09G165700

Position : Chr09 ( 5`- 38956622 .. 38960450 -3` )
Annotation :
External links : CoGe
PGDD synteny : Glyma.09G165700

Protein [Map View]
MSGKASVSKELHAKHTKILEGLVKLPDNRECADCRTKAPRWASVNLGIFICMQCSGIHRSLGVHISKVRSTTLDTWLPDQ
ISFMQLMGNAKSNKHWEAELPPNFDRNGYGVEKFIRSKYVEKRWASKGGLQPASKSAEIIFNSNKSPASGAKSAIQNRRL
SLEESILVKHMAQIRSPITRSHEGSSDLQKKNSPPPIRRPSASFDFDYSRGKNNGTVDHFGLLSIHDSKQDFSTTPPSWT
TFD*

DNA
ATGAGCGGAAAAGCCTCCGTCTCTAAGGAGCTCCATGCCAAGCACACCAAGATATTAGAGGGACTTGTTAAGCTACCTGA
CAACAGGGAATGTGCAGACTGCAGGACCAAGGCACCACGATGGGCAAGTGTGAACTTAGGGATATTCATTTGCATGCAAT
GTTCAGGAATTCACCGGAGTCTTGGAGTGCATATATCAAAGGTGCGGTCCACAACTTTGGATACATGGTTGCCAGATCAA
ATTTCTTTTATGCAATTAATGGGTAATGCGAAGTCAAATAAGCACTGGGAGGCAGAATTACCGCCAAATTTTGACAGAAA
TGGATATGGAGTCGAGAAGTTTATTCGTTCCAAGTATGTGGAGAAAAGATGGGCTTCAAAAGGTGGACTACAACCAGCTT
CAAAGTCAGCTGAAATAATCTTTAACTCGAATAAGTCACCAGCTTCTGGGGCCAAGAGTGCTATTCAGAATAGGAGATTG
TCTCTTGAGGAAAGCATTCTTGTGAAACACATGGCACAAATTCGGTCTCCAATAACGAGATCTCATGAGGGCTCCTCAGA
TTTGCAAAAGAAGAATTCACCACCACCAATAAGGAGGCCATCTGCATCATTTGATTTTGACTACTCTAGGGGAAAGAACA
ATGGTACTGTTGATCATTTTGGCTTGCTTTCCATCCATGATAGTAAACAGGATTTCTCAACTACACCTCCTAGCTGGACA
ACATTTGATTGA