Details for Soybean Locus Glyma.08G193400

Position : Chr08 ( 5`- 15573471 .. 15577477 -3` )
Annotation :
External links : CoGe
PGDD synteny : Glyma.08G193400

Protein [Map View]
MKKKMMASTAISLVFAALFLFSSVHSFYLPGVAPRDFQIGDPLFVKVNKLSSTKTQLPYDYYFLKYCKPKTILNNAENLG
EVLRGDRIENSVYTFHMRKEQSCTVVCHETLDAESAKSFKEKIDDEYRVNMILDNLPVAVRRQRRDGGQSTTYEHGFRVG
FKGNYQGSKEEKYFINNHLSFRVMYHKDPETGSARIVGFEVTPNSINHEYKEWNDKNPQVTTCNKDTKNLMQGSTVPQEV
DTSKDIVFTYDVSFTESDIKWASRWDTYLLMNDDQIHWFSIINSLMIVLFLSGMVAMIMMRTLFRDIANYNQLETQDEAQ
EETGWKLVHGDVFRPPINSNLLCVYVGTGVQIFAMTLVTMIFALLGFLSPSNRGGLMTAMVLLWVFMGLFAGYSSARLYK
MFKGTEWKRNTLKTAFMFPGILFAVFFVLNALIWGEQSSGAVPFGTMFALVCLWFGISVPLVFVGSYLGFKKPAIEDPVK
TNKIPRQVPEQAWYMKSVFSILIGGILPFGAVFIELFFILTSIWLNQFYYIFGFLFIVFVILLITCAEITIVLCYFQLCS
EDYNWWWRSYLTAGSSALYLFLYSIFYFFTKLEISKLVSGILYFGYMIIVSYAFFVLTGTIGFYACFWFVRKIYSSVKID
*

DNA
ATGAAGAAGAAGATGATGGCAAGCACGGCCATCTCCCTCGTCTTCGCCGCGCTCTTCCTCTTCTCCTCCGTCCACTCTTT
CTACCTCCCTGGTGTCGCTCCTCGCGATTTCCAAATTGGTGACCCCCTCTTTGTCAAAGTGAACAAGTTATCATCTACCA
AGACTCAACTTCCATATGACTACTACTTCTTGAAGTATTGCAAACCCAAAACGATATTGAACAATGCAGAAAATTTGGGA
GAGGTTCTTAGAGGTGATCGTATTGAGAATTCAGTATATACATTTCATATGAGGAAGGAACAGTCATGTACTGTTGTTTG
TCATGAAACATTGGATGCTGAATCTGCAAAGAGTTTTAAAGAAAAAATTGATGATGAATATCGAGTGAACATGATTTTGG
ATAACCTTCCAGTTGCTGTTCGTAGACAAAGGAGGGATGGAGGTCAATCAACAACATATGAACATGGTTTTCGTGTTGGG
TTCAAAGGAAACTATCAAGGGAGCAAGGAGGAGAAGTATTTTATTAATAACCACTTGAGTTTCAGAGTCATGTATCACAA
GGATCCTGAAACTGGTTCTGCTCGTATTGTTGGATTTGAGGTCACCCCAAACAGTATAAATCATGAATACAAGGAGTGGA
ATGACAAGAATCCACAGGTAACAACATGCAATAAAGATACCAAGAATTTGATGCAAGGTAGTACTGTCCCACAAGAAGTT
GATACAAGCAAGGATATTGTATTCACATATGATGTTTCCTTCACGGAAAGTGATATCAAATGGGCATCACGGTGGGACAC
ATATCTTTTAATGAATGATGATCAGATCCACTGGTTCTCCATCATTAACTCTCTGATGATTGTTCTTTTCCTGTCTGGAA
TGGTGGCAATGATCATGATGAGAACTCTTTTCAGAGACATTGCCAATTATAATCAGCTAGAAACCCAAGATGAGGCCCAA
GAAGAAACAGGGTGGAAACTTGTTCATGGAGATGTTTTTAGGCCACCAATCAATTCAAATTTGCTTTGTGTTTATGTTGG
TACTGGTGTTCAGATCTTTGCAATGACACTTGTGACAATGATATTTGCTTTGCTAGGGTTTTTGTCTCCATCTAATCGGG
GAGGTCTAATGACTGCAATGGTTCTGTTGTGGGTTTTTATGGGCTTATTTGCTGGCTACTCCTCAGCACGTTTGTACAAG
ATGTTCAAGGGCACAGAATGGAAAAGGAACACCTTGAAAACTGCATTTATGTTCCCGGGCATTCTTTTTGCTGTCTTCTT
TGTGCTGAATGCTTTAATCTGGGGGGAGCAGTCCTCCGGGGCCGTCCCTTTTGGAACAATGTTTGCTCTAGTCTGCTTAT
GGTTTGGTATATCAGTACCCCTGGTCTTTGTGGGCAGTTACTTGGGCTTTAAAAAGCCGGCAATTGAAGACCCAGTGAAG
ACTAATAAAATTCCTAGGCAGGTACCTGAGCAGGCATGGTATATGAAATCCGTCTTCTCAATTCTTATTGGAGGCATTCT
TCCATTTGGTGCAGTGTTCATCGAGCTCTTCTTTATCCTGACATCAATATGGCTGAACCAGTTCTATTACATCTTCGGCT
TTCTTTTCATAGTGTTTGTGATCCTATTAATCACCTGTGCCGAGATTACCATTGTGCTTTGCTACTTCCAATTGTGCAGT
GAGGATTACAATTGGTGGTGGAGATCTTACCTCACTGCTGGGTCCTCTGCGCTGTACCTTTTCCTCTACTCAATTTTCTA
CTTCTTTACCAAGTTGGAGATTTCAAAGCTGGTCTCGGGCATCCTTTACTTTGGATACATGATAATTGTTTCATATGCCT
TCTTTGTGTTGACGGGAACTATCGGCTTCTATGCATGCTTCTGGTTTGTTCGCAAGATCTACTCGTCGGTGAAGATTGAC
TGA