Details for Soybean Locus Glyma.08G192500

Position : Chr08 ( 5`- 15486015 .. 15489058 -3` )
Annotation :
External links : CoGe
PGDD synteny : Glyma.08G192500

Protein [Map View]
MDHYGSSGGSWTMIPTHNSQSQSNQDPNLFLQQQQQFLQSQPFQQALAPQSPFQQQQQQRLLQQQQQQQQPQNLHQSLAS
HYHLLHLVENLAEVIEHGTPDQPSDALINESSNHFEKCLQLLNSISGSISTKAMTVEGQKKKLEESEQLLNQRRDLIGNY
RKSVEDLVRSEPVENVVL*

DNA
ATGGATCACTATGGTTCTTCTGGAGGAAGCTGGACAATGATCCCAACCCACAATTCCCAATCCCAATCGAACCAGGACCC
TAACCTCTTTCTGCAACAACAACAACAGTTTCTCCAGTCACAACCTTTTCAGCAAGCACTAGCGCCTCAATCTCCATTTC
AACAGCAGCAGCAGCAGCGTCTTCTACAGCAACAGCAACAACAACAACAGCCGCAGAACCTTCACCAGTCACTGGCCTCT
CACTACCATCTCTTACACTTGGTGGAGAATTTGGCTGAGGTTATCGAACATGGAACCCCGGATCAGCCGTCTGATGCATT
GATCAATGAATCGAGCAACCACTTTGAGAAGTGCCTGCAGCTGCTAAACTCAATCTCTGGCTCCATTAGCACCAAGGCTA
TGACAGTTGAGGGACAGAAGAAGAAGCTAGAGGAAAGTGAGCAATTGCTAAATCAGCGAAGAGACTTGATTGGCAATTAC
AGAAAATCTGTGGAGGATCTTGTTAGGTCTGAGCCAGTAGAGAATGTTGTGCTTTAG