Details for Soybean Locus Glyma.07G105500

Position : Chr07 ( 5`- 10213268 .. 10214214 -3` )
Annotation :
External links : CoGe
PGDD synteny : Glyma.07G105500

Protein [Map View]
MALIRRRHPNLCLPISKPIQCRPHFPLYLTLTTTKRTTNDAITIDDLAKLIILGHGNGRTVYKVYHKVTSITYELKIIHG
EIDAITHCHALLEASILRRTIDCLHVDHFHSSFEMPIGDVAILMEYMGVLNGLAYLHAHNIAHRDIKPANIIINTQGKSL
GLTLFELYVGHFPLLQEGQRPNWATLICVICFDEPSSPPETASPEFCNFVECCIKKESSERWTTSQLLTHPFVCKNSKPC
*

DNA
ATGGCCCTTATTCGTCGTCGCCACCCTAACCTCTGCCTCCCCATCTCTAAGCCTATTCAGTGTCGCCCCCACTTCCCCCT
TTACTTAACCCTCACCACCACCAAACGCACCACCAATGATGCCATCACCATTGATGACCTTGCGAAACTCATTATTCTCG
GCCATGGAAATGGCAGAACCGTCTACAAGGTCTACCATAAAGTCACCTCCATCACTTACGAGTTGAAGATCATCCATGGT
GAAATTGACGCCATCACACACTGTCATGCACTCTTAGAAGCATCAATTCTTCGTCGTACCATTGATTGCCTCCATGTGGA
TCACTTTCATAGCTCTTTCGAGATGCCCATCGGTGATGTGGCAATCCTCATGGAGTACATGGGCGTCCTTAATGGCCTTG
CATACCTTCACGCACACAACATTGCGCATCGTGACATCAAGCCCGCAAACATTATCATAAACACTCAAGGGAAGAGTTTG
GGTTTGACACTTTTTGAACTCTATGTGGGTCACTTCCCATTACTTCAAGAGGGTCAAAGGCCCAATTGGGCCACTCTTAT
ATGCGTCATTTGCTTTGATGAACCATCGAGCCCCCCAGAGACTGCATCACCAGAATTTTGCAACTTTGTTGAGTGTTGCA
TCAAGAAGGAGTCTAGCGAAAGGTGGACAACGAGTCAACTCTTGACCCACCCATTTGTTTGCAAAAACTCAAAACCTTGT
TAA