Details for Soybean Locus Glyma.06G142900

Position : Chr06 ( 5`- 11634918 .. 11636457 -3` )
Annotation :
External links : CoGe
PGDD synteny : Glyma.06G142900

Protein [Map View]
MASSLGIACGGNNAKLGIPKQRCGSVLQPPCSLAMGRSTARVGRITAAMATATAVMTTATAKEQETTTPMMMAMELFGKR
DGGAKNDAVEGQERLDRWMRESVVEIVKNLKEAPLLVQVFPKSATMTTEKRMVVEDWPAVKERWESGETPVPEGVIFVEE
LDGDTAEDGGGERTTRAWGVVVQGKGVGCGPVCYLLKTVRVGSGPGSGMGICSTHFCLVKVKDFRETVQSQLKNCWLLQS
QCQWNNYK*

DNA
ATGGCGTCGTCTCTGGGAATTGCTTGCGGTGGAAACAACGCCAAATTAGGGATCCCAAAGCAGCGGTGTGGTTCGGTTCT
TCAGCCGCCGTGCTCCCTCGCTATGGGGCGCTCGACGGCGAGGGTGGGGAGGATCACGGCGGCGATGGCCACGGCCACGG
CGGTGATGACCACGGCCACGGCGAAGGAGCAAGAGACTACCACTCCGATGATGATGGCAATGGAGCTGTTCGGGAAACGC
GATGGAGGAGCCAAAAACGACGCTGTTGAGGGACAGGAGAGGCTGGACAGGTGGATGAGAGAGTCGGTGGTGGAGATCGT
GAAGAATTTGAAAGAAGCGCCTCTGCTGGTGCAGGTTTTTCCCAAATCGGCGACGATGACGACGGAGAAGAGGATGGTGG
TGGAGGACTGGCCGGCGGTAAAGGAGCGCTGGGAATCCGGTGAGACGCCGGTGCCGGAGGGAGTCATATTCGTGGAGGAG
TTGGACGGAGACACGGCGGAGGATGGCGGCGGAGAGAGGACGACGAGGGCGTGGGGGGTGGTGGTTCAGGGGAAGGGCGT
CGGGTGCGGCCCGGTTTGTTATCTTTTAAAGACCGTTCGGGTCGGGTCAGGACCCGGTTCGGGAATGGGGATTTGTTCGA
CCCATTTTTGTTTGGTGAAAGTGAAGGACTTCAGGGAAACGGTGCAGTCGCAGCTAAAAAATTGTTGGCTTTTGCAGAGC
CAGTGCCAGTGGAATAACTATAAATGA