Details for Soybean Locus Glyma.06G142500

Position : Chr06 ( 5`- 11608177 .. 11612933 -3` )
Annotation :
External links : CoGe
PGDD synteny : Glyma.06G142500

Protein [Map View]
MRVLFSSMRVFLLLVWLLELVCVSVTAVNPSLNDDVLGLIVFKADIRDPKGKLASWNEDDESACGGSWVGVKCNPRSNRV
VEVNLDGFSLSGRIGRGLQRLQFLRKLSLANNNLTGGINPNIARIDNLRVIDLSGNSLSGEVSDDVFRQCGSLRTVSLAR
NRFSGSIPSTLGACSALASIDLSNNQFSGSVPSGVWSLSALRSLDLSDNLLEGEIPKGVEAMKNLRSVSMTRNRLTGNVP
FGFGSCLLLRSIDLGDNSFSGSIPGDLKELTLCGYLSLRGNAFSREVPEWIGEMRGLETLDLSNNGFTGQVPSSIGNLQL
LKMLNFSGNGLTGSLPESIVNCTKLSVLDVSRNSMSGWLPLWVFKSDLDKGLMSENVQSGSKKSPLFALAEVAFQSLQVL
DLSHNAFSGEITSAVGGLSSLQVLNLANNSLGGPIPAAIGELKTCSSLDLSYNKLNGSIPWEIGRAVSLKELVLEKNFLN
GKIPSSIENCSLLTTLILSQNKLSGPIPAAVAKLTNLRTVDVSFNSLTGNLPKQLANLANLLTFNLSHNNLQGELPAGGF
FNTISPSSVSGNPSLCGAAVNKSCPAVLPKPIVLNPNTSTDTGPGSLPPNLGHKRIILSISALIAIGAAAVIVIGVISIT
VLNLRVRSSTPRDAAALTFSAGDEFSRSPTTDANSGKLVMFSGEPDFSSGAHALLNKDCELGRGGFGAVYQTVLRDGHSV
AIKKLTVSSLVKSQEDFEREVKKLGKIRHQNLVELEGYYWTTSLQLLIYEYVSGGSLYKHLHEGSGGNFLSWNERFNVIL
GTAKALAHLHHSNIIHYNIKSTNVLLDSYGEPKVGDFGLARLLPMLDRYVLSSKIQSALGYMAPEFACKTVKITEKCDVY
GFGVLVLEIVTGKRPVEYMEDDVVVLCDMVRGALEEGRVEECIDERLQGKFPAEEAIPVMKLGLICTSQVPSNRPDMGEV
VNILELIRCPSEGQEELA*

DNA
ATGCGAGTGCTATTTTCAAGCATGAGAGTTTTTCTTCTTCTTGTGTGGTTGTTGGAGCTGGTTTGTGTTTCGGTGACCGC
CGTGAACCCTTCTCTGAACGACGACGTTTTGGGGCTTATAGTGTTCAAAGCTGACATACGAGATCCGAAGGGGAAGCTCG
CTTCTTGGAACGAGGACGATGAGAGCGCGTGTGGTGGTAGTTGGGTTGGGGTGAAGTGCAACCCTAGATCCAATAGAGTG
GTGGAGGTTAACCTTGATGGGTTCTCGCTCTCTGGGAGAATAGGTAGAGGGTTGCAAAGGTTGCAGTTTCTAAGAAAGCT
TTCACTGGCGAATAATAACCTCACTGGTGGGATAAACCCCAACATTGCTCGGATTGATAACCTTAGGGTCATTGACTTGA
GTGGGAATAGTCTCTCAGGGGAGGTTTCTGATGATGTTTTCCGACAATGTGGGTCTCTCAGGACTGTTTCCTTGGCCAGG
AACAGGTTTTCTGGGAGCATTCCCTCTACTTTGGGGGCATGTTCTGCTCTTGCTTCTATCGACCTTTCTAATAACCAGTT
TTCTGGTTCTGTTCCCTCCGGGGTTTGGTCCTTGAGTGCTCTCAGGTCTCTGGATTTGTCTGATAACTTGTTGGAGGGTG
AGATTCCTAAGGGGGTTGAGGCGATGAAGAATTTGAGGAGTGTTAGTATGACGAGGAATCGGTTGACCGGGAATGTTCCT
TTTGGGTTTGGGAGTTGTTTGCTATTGAGGTCTATTGATTTAGGGGATAATTCTTTTTCTGGGAGTATTCCTGGTGATCT
TAAGGAACTTACATTGTGTGGTTATCTTAGCTTGCGTGGGAATGCTTTCTCGAGGGAGGTTCCTGAGTGGATTGGGGAGA
TGAGAGGGCTTGAGACGTTGGACCTTTCGAACAATGGGTTTACCGGTCAGGTGCCGAGCTCTATTGGAAATCTTCAGTTG
CTGAAGATGTTAAATTTTTCTGGAAATGGTCTCACTGGTAGTCTGCCGGAGTCTATTGTGAATTGCACAAAACTTTCGGT
GTTGGATGTCAGCCGGAATTCGATGTCCGGGTGGCTTCCGTTGTGGGTTTTCAAGTCAGATTTGGACAAGGGTTTGATGT
CAGAAAATGTACAGAGTGGGAGCAAGAAAAGCCCTTTGTTTGCCTTGGCTGAAGTCGCGTTTCAAAGTCTTCAGGTTTTG
GATTTGTCTCACAATGCGTTTTCTGGCGAAATCACATCTGCAGTTGGAGGTTTAAGCAGCTTGCAGGTTTTGAATTTAGC
AAACAACTCTCTCGGAGGTCCTATTCCAGCTGCCATTGGTGAATTGAAAACATGTTCAAGTCTTGATTTGAGCTATAATA
AGCTGAATGGAAGCATACCTTGGGAAATAGGAAGAGCTGTGTCCTTGAAAGAACTGGTATTGGAAAAGAACTTCCTAAAT
GGGAAAATTCCATCGTCAATTGAGAACTGCTCTTTGCTAACAACTTTGATTCTGTCCCAGAACAAGCTGAGTGGTCCAAT
ACCTGCAGCAGTTGCAAAACTTACTAACCTGCGAACTGTGGATGTATCGTTTAACAGTCTCACTGGAAACCTTCCTAAGC
AATTGGCCAACCTTGCCAATCTTCTTACCTTCAATTTATCTCACAACAACCTTCAGGGTGAGCTGCCGGCTGGTGGTTTT
TTCAACACCATTTCGCCTTCCTCTGTTTCTGGCAATCCATCTCTTTGTGGCGCTGCAGTAAACAAATCATGCCCTGCTGT
CCTCCCAAAGCCTATTGTTCTAAATCCCAACACCTCTACTGACACTGGTCCGGGTTCATTGCCTCCAAATTTGGGTCATA
AAAGAATCATTCTCAGCATTTCTGCACTCATTGCCATTGGTGCAGCTGCTGTCATTGTAATTGGTGTTATTAGCATCACT
GTTCTCAATCTCCGTGTTCGCTCCTCTACACCTCGTGATGCAGCTGCCCTCACATTTTCTGCAGGGGACGAATTCAGCCG
TTCCCCGACTACAGATGCTAACTCTGGCAAGCTTGTCATGTTTTCGGGTGAGCCTGATTTCAGTTCTGGTGCGCATGCTT
TGCTTAATAAGGATTGTGAGCTTGGGCGTGGAGGATTTGGAGCAGTGTACCAAACTGTTCTTAGAGATGGACATTCAGTT
GCTATAAAGAAGCTCACTGTGTCAAGCCTTGTCAAGTCTCAAGAAGATTTTGAAAGAGAAGTGAAGAAATTAGGAAAAAT
CAGACACCAAAACCTCGTGGAACTCGAGGGTTATTATTGGACTACATCGCTGCAGCTGCTCATATACGAGTATGTCTCCG
GTGGTAGTCTGTATAAGCATCTCCATGAAGGATCTGGTGGGAACTTCCTCTCATGGAATGAGAGGTTTAATGTGATTCTC
GGAACAGCGAAGGCCTTGGCACACTTGCACCATTCCAACATTATTCACTATAACATTAAGTCAACCAATGTCCTTCTTGA
TAGTTACGGTGAACCAAAAGTAGGGGACTTTGGCCTAGCAAGACTGTTGCCAATGCTTGATCGATACGTTTTGAGCAGCA
AAATTCAGAGCGCACTCGGCTACATGGCGCCAGAGTTTGCCTGCAAGACGGTGAAAATCACCGAGAAATGCGATGTATAT
GGGTTTGGTGTCTTGGTCTTGGAGATCGTCACAGGGAAGAGGCCAGTCGAATACATGGAGGATGATGTGGTGGTACTATG
CGACATGGTGAGAGGGGCTTTGGAAGAAGGCAGGGTGGAGGAGTGCATTGATGAGAGGCTCCAAGGGAAGTTCCCAGCAG
AAGAAGCTATTCCTGTCATGAAACTAGGCTTAATATGTACTTCTCAAGTGCCATCTAACAGGCCTGACATGGGAGAGGTA
GTTAACATATTGGAGCTGATAAGATGTCCCTCGGAAGGACAAGAAGAATTGGCATGA