Details for Soybean Locus Glyma.06G142000

Position : Chr06 ( 5`- 11559878 .. 11562766 -3` )
Annotation :
External links : CoGe
PGDD synteny : Glyma.06G142000

Protein [Map View]
MSILFPRSSSAAKRKRVIRELVQGRDYATQLKFLLQKPIGPDGSVSAKELVANVLRSFAETLSVLTSSSEDSTSGHDHDD
EVIAQNLVISGEDASQVASINDPSSEDSTESRKGSKDRRGSYKRRKTEQTWTIVAQTTDDNHAWRKYGQKEILNSQFPRS
YFRCTRKFEQGCRATKQVQRIQENPDRYNITYIGFHTCKDTLKAPQVVTHSKTWDSFLGPESNVPNEHYSTIGSQSQIVI
QEYPNDETDPSDLTDANLWSDLKDFELSNDKPAGLKIAPENADSVYSCTGSRSLDMDFGIFSPHFCSTEDFHFDESQLL*

DNA
ATGAGTATTCTCTTCCCAAGAAGTTCCTCAGCAGCAAAGAGGAAAAGGGTCATTAGAGAACTTGTTCAGGGTCGAGACTA
TGCTACTCAGTTGAAGTTTCTGCTTCAGAAGCCTATTGGCCCTGATGGGTCTGTTTCTGCTAAGGAACTTGTGGCCAATG
TGCTGAGATCTTTCGCTGAAACTCTCTCTGTGTTGACTTCTTCTTCCGAGGATTCAACAAGTGGTCATGATCATGACGAC
GAGGTTATTGCTCAGAATCTTGTAATTTCCGGAGAAGATGCCTCGCAGGTGGCAAGCATTAATGATCCGAGTTCTGAGGA
TTCGACTGAGAGTAGGAAGGGATCAAAGGATCGGAGAGGGTCCTATAAAAGAAGGAAGACTGAACAGACATGGACTATAG
TTGCCCAAACTACTGATGATAATCATGCATGGAGAAAGTACGGACAAAAGGAAATCCTAAATTCTCAATTTCCCAGGAGT
TACTTCAGGTGCACTAGAAAGTTTGAACAAGGTTGCCGAGCAACCAAACAAGTGCAACGGATACAAGAGAATCCCGATAG
GTACAACATTACGTACATAGGCTTTCACACATGCAAAGACACCCTCAAGGCTCCACAAGTGGTGACACATTCTAAAACTT
GGGACTCATTTCTTGGTCCTGAATCAAATGTGCCAAATGAACATTATTCCACCATTGGATCACAAAGCCAAATTGTAATA
CAAGAATATCCCAACGATGAGACTGATCCAAGTGATCTCACAGATGCTAACCTGTGGTCTGATTTGAAGGATTTTGAACT
ATCCAATGACAAGCCTGCAGGTTTGAAAATAGCACCTGAAAATGCAGATTCTGTGTATTCATGCACTGGCTCGAGAAGTT
TGGACATGGATTTTGGGATATTCTCTCCTCATTTCTGCAGCACCGAGGACTTCCACTTTGATGAAAGCCAATTGCTTTAG