Details for Soybean Locus Glyma.06G141400

Position : Chr06 ( 5`- 11529305 .. 11534400 -3` )
Annotation :
External links : CoGe
PGDD synteny : Glyma.06G141400

Protein [Map View]
MSGDLAPKLRVVRCPKCRLLLEEPAGCDLYKCGECGTTLQAKKRTNVAANSKSSVQATDATPRNASDHVSEGKQRNNRNH
LVPSREDSLKERETSSGECHVDGNAGRGQNENGDQLVPFILSDEGQETESDIYSLSHRRHRVSIKGGSASNKTTHSEIGE
INDGNLEEEAEEESVCALDEDGDNDRSALIGVTSEKEITEGDLEGVEGLNNENLSLEGEKEFISDSDGEDDNEEESALAG
AILEVEITESDSVGAEDLNDGNLLPEGAEELSSALERKDANNDKSVIVGENLELETTEKNIAEELNDGKLSEGAEHAPDG
EDSNNDPSAIEGAKPEVDTTENASTTDRTSREKGNILHVTPDKVEEGTPANPTSSHKQQKKAKKIIHRGSDRVRSVDTTE
LIDPSSELSGILAGKLPKSPTTRSSFAYDGSLSSYDGMDEPFPIQHSGSFDNTYTNANGVSEGRTRKGKGLVNSIYGGLE
TQHQSHMSNAKLHAKKDSRGNQNKVVDSTRNGHQRWMGTKRDEFPPKIPLHRSGSHSYYERGSSSNQMHDALYHSSSFLS
PDSSEDTDHEKMKLLRMINKLQDQLSRTLYKGGETNGRLPKGVSYKGNHISAYHSHDFGEGRRFSHSLDYPSCDGRCGHG
VNWHQRHHKFSRIPYSAEATRNAHHVDHSCYHCFSQERHFSTDMSMSPHVLFQHEGLHGSCSGQDCCSFSHHSYPSSPQW
FIASKLPPIYGRKTKSDEQRRRAPDLKKYLREKKNLVAKRHHRPVAGGAPFVTCHKCLNLLQLPADFLLFERACHQLICG
ECSEVLKFSMHGSHIDFFSPNNAIGPPSSDLNGRSEVISSRNLPSASHANYYHYSATEAISYYDDYGLSISKSYSSEGEP
VSLAHSHHLHSGEYANPSVSHGTFEPSTEKENINPRYSSARKGQVETDASAMFSSNMSGSRKMASEMEARPAPKSSSLHL
LMGYSSPSQVIRGTRPSVEGN*

DNA
ATGTCTGGCGACTTGGCTCCCAAACTTCGGGTAGTTAGATGTCCTAAATGCCGGCTGCTTCTTGAAGAGCCTGCAGGGTG
TGATTTGTACAAGTGTGGTGAATGTGGCACTACTCTTCAAGCTAAGAAACGAACAAATGTGGCTGCCAACTCAAAGTCCA
GTGTACAAGCAACTGATGCAACTCCTAGGAATGCATCGGATCATGTTTCTGAGGGGAAACAACGTAACAATAGAAACCAT
CTGGTTCCTTCACGGGAAGATAGTTTGAAGGAAAGAGAAACTTCTTCTGGAGAGTGTCATGTGGATGGAAATGCTGGAAG
GGGTCAAAACGAAAATGGTGATCAACTTGTACCGTTTATTTTATCAGATGAAGGACAGGAAACTGAATCGGATATCTATA
GTTTGTCACACAGAAGGCATAGAGTGTCCATCAAAGGTGGTTCAGCTTCAAATAAGACCACTCACTCTGAGATTGGGGAA
ATAAATGATGGAAACTTAGAAGAAGAAGCAGAAGAGGAGTCTGTTTGTGCATTGGATGAAGATGGCGATAATGATAGATC
AGCTCTGATAGGGGTAACATCTGAAAAGGAAATTACTGAAGGTGATTTAGAAGGAGTAGAAGGGTTAAATAATGAAAACT
TGTCACTAGAAGGAGAGAAAGAGTTCATTTCTGACTCAGATGGAGAAGATGACAATGAAGAGGAATCAGCTCTAGCAGGT
GCAATCCTTGAAGTGGAAATTACTGAAAGTGATTCAGTCGGAGCCGAAGACTTAAATGATGGAAACTTGTTACCAGAGGG
AGCAGAGGAGTTAAGTTCTGCATTGGAGCGAAAAGATGCCAATAATGACAAATCAGTTATAGTTGGTGAAAACCTTGAAT
TGGAAACCACTGAAAAGAATATAGCAGAAGAGTTAAATGATGGTAAATTGTCAGAGGGAGCAGAACATGCACCGGATGGA
GAAGATTCCAACAATGATCCATCGGCTATAGAGGGTGCAAAACCTGAAGTGGACACTACAGAAAATGCTTCTACGACTGA
TAGGACAAGTAGAGAGAAGGGAAACATTTTACATGTTACTCCTGATAAAGTTGAAGAAGGCACACCTGCTAATCCTACAT
CTTCTCATAAACAACAGAAGAAAGCTAAGAAAATTATTCACCGTGGCTCTGACCGTGTAAGGTCTGTGGATACAACAGAA
TTAATTGATCCCAGTTCAGAGCTTAGTGGTATACTTGCTGGAAAATTGCCTAAATCCCCAACCACTAGAAGCTCTTTTGC
TTATGATGGCAGCCTCTCTTCTTATGATGGAATGGATGAGCCGTTCCCTATCCAACATTCAGGTTCATTCGACAACACTT
ACACCAATGCTAATGGTGTTTCTGAGGGAAGGACCAGAAAGGGTAAAGGCCTTGTGAATAGCATATATGGAGGCCTTGAA
ACACAACATCAATCACATATGTCCAATGCAAAGCTTCATGCCAAGAAAGACAGCAGGGGGAATCAAAACAAAGTGGTGGA
CTCTACAAGAAATGGTCATCAACGTTGGATGGGCACAAAGAGAGATGAGTTTCCACCCAAAATACCTTTGCATCGAAGTG
GTTCCCATTCTTACTATGAAAGGGGCAGCTCATCAAACCAAATGCATGATGCGCTCTACCACAGCTCAAGCTTTCTTTCA
CCTGATTCCTCTGAGGACACTGACCATGAGAAGATGAAACTGTTGAGAATGATTAATAAGTTGCAAGATCAACTCAGCAG
GACTCTCTACAAAGGTGGAGAAACAAATGGAAGACTGCCCAAGGGTGTCTCTTACAAGGGAAATCATATTTCTGCATATC
ATAGCCATGACTTTGGTGAGGGAAGAAGGTTTTCTCATAGTTTGGATTACCCTTCGTGTGATGGAAGATGTGGTCATGGA
GTTAACTGGCACCAAAGGCATCATAAATTCTCGCGGATACCTTATTCAGCCGAGGCAACAAGGAATGCACACCATGTTGA
TCATTCTTGTTACCATTGTTTTTCCCAAGAGAGGCATTTCTCAACAGATATGTCAATGTCACCACATGTTCTTTTCCAGC
ATGAAGGGTTACATGGGTCCTGTTCAGGCCAAGATTGTTGCTCTTTTTCTCATCACTCTTATCCTTCAAGTCCACAATGG
TTCATAGCCTCTAAACTTCCACCAATATATGGCCGCAAAACAAAATCTGATGAACAGAGGCGTAGGGCTCCCGACTTAAA
GAAATACTTAAGGGAGAAAAAGAACTTGGTGGCCAAGAGACATCACAGGCCAGTGGCAGGTGGAGCTCCTTTTGTCACTT
GTCATAAATGCTTAAACCTGTTGCAGCTACCTGCAGATTTTCTCCTTTTCGAAAGGGCATGTCATCAGCTGATATGTGGA
GAATGTTCAGAGGTGCTAAAGTTTTCAATGCATGGAAGCCATATAGATTTTTTCTCACCAAATAATGCTATAGGTCCTCC
ATCAAGTGACCTTAATGGTCGAAGCGAGGTGATTAGTAGCAGAAATCTACCTTCAGCATCTCATGCCAACTATTACCATT
ATTCAGCTACTGAGGCCATTTCATATTATGATGATTATGGACTTTCTATCTCTAAAAGCTACTCCTCAGAAGGAGAGCCT
GTTTCTCTGGCACATTCTCATCACTTGCACAGCGGTGAATATGCTAATCCAAGTGTCTCTCATGGTACATTTGAGCCTTC
AACTGAGAAGGAGAACATTAATCCAAGATATTCTAGTGCAAGAAAGGGTCAGGTGGAGACAGATGCATCAGCTATGTTTT
CCTCCAATATGTCTGGATCCAGGAAAATGGCATCAGAAATGGAGGCTAGGCCAGCACCAAAAAGTTCATCACTTCATCTA
CTAATGGGTTATTCTTCACCAAGTCAAGTGATAAGAGGGACTCGGCCTTCTGTTGAAGGTAATTAA