Details for Soybean Locus Glyma.06G141000

Position : Chr06 ( 5`- 11486712 .. 11491994 -3` )
Annotation :
External links : CoGe
PGDD synteny : Glyma.06G141000

Protein [Map View]
MQMSRFTQFRALLRGTTSHQRSPLRHPAVADSSFASKPSVSNASAFRPSSPVFHPQQRLGNSTFRFFSSNFDKGFAQKVF
DKPAAAVTSAFSRYREAIGLQIEAFFKRNTLFLWGAGGVVLCAVLWRILFGIANLFVGLSEGMAKYGFLALSSAIVAFTG
LYIRTRLTINPDKVYRMAMTKLNTSAGILEVMGAPLSGTDLRAYIMSGGGLTVKKFKPSVRSRRCFLIFPIRGSEKKGLV
SVEVKKKKGQYDMKLLAVDVPMASGPDQRLFLIGDEEEYRVGGGLISDLRDPVVRAMAATKEFDDLDEIEEEEDAERERQ
ETERKEREEIEKLEKSSGT*

DNA
ATGCAAATGTCAAGATTCACCCAATTCCGAGCTCTACTCCGCGGCACCACCAGCCACCAGCGCTCCCCTCTCCGCCACCC
CGCCGTCGCCGATTCTTCATTTGCATCAAAACCCTCAGTCTCTAATGCCTCCGCGTTCCGCCCCTCTTCGCCGGTGTTCC
ACCCGCAACAACGCCTCGGCAATAGCACCTTTCGATTCTTCTCCTCCAATTTCGACAAAGGATTTGCGCAGAAGGTGTTT
GATAAGCCTGCGGCAGCAGTGACTTCGGCCTTTTCGCGGTACCGCGAGGCAATTGGGTTGCAAATCGAGGCGTTCTTCAA
GAGGAATACTCTGTTTCTTTGGGGCGCCGGTGGAGTTGTGCTCTGCGCCGTTCTATGGAGGATCCTTTTCGGGATCGCCA
ACCTCTTCGTTGGACTCTCCGAAGGCATGGCTAAGTATGGCTTCCTTGCCCTTTCATCTGCTATCGTTGCTTTTACTGGC
TTGTATATTCGCACGAGGCTCACAATCAACCCGGATAAAGTTTATAGAATGGCCATGACAAAACTTAACACGTCAGCTGG
GATTCTTGAAGTTATGGGTGCTCCTCTTTCTGGAACTGATTTGAGAGCATATATCATGTCAGGGGGTGGGCTCACTGTAA
AGAAGTTCAAGCCAAGTGTTAGAAGCCGACGGTGTTTTCTAATTTTCCCCATAAGAGGGTCTGAGAAAAAGGGTCTAGTC
AGTGTTGAAGTCAAGAAAAAGAAGGGTCAGTATGATATGAAGCTGCTGGCTGTTGATGTTCCCATGGCTTCTGGTCCAGA
CCAGCGGTTGTTTCTAATTGGGGATGAAGAAGAGTACAGGGTCGGTGGGGGGCTAATATCTGATCTTAGAGACCCAGTAG
TGAGAGCAATGGCAGCAACCAAGGAATTTGATGATCTTGATGAGATTGAGGAAGAGGAAGATGCTGAAAGAGAACGTCAA
GAGACTGAAAGAAAGGAGCGTGAAGAGATTGAAAAGCTGGAAAAGAGTAGTGGCACCTAG