Details for Soybean Locus Glyma.04G224300

Position : Chr04 ( 5`- 49475519 .. 49486851 -3` )
Annotation :
External links : CoGe
PGDD synteny : Glyma.04G224300

Protein [Map View]
MLAGAPSSHMSSSVSTSQGIFPTSRIGSGESPNSGASSFTQPIADMNENDETDLLSISWNQDYGCFAAGTSHGFRIYNCE
PCKETFRRDLKSGGFKIVEMLFRCNILALVGAVANSHYPPNKVLIWDDHQSRCIGEFTFRSDVRGVKLRRDRIVVVLEHK
IYVYNFTDLKLLHQIETLANPRGLCCLSHHSNTFVLACPGLHKGHVRVEHFGLNVTKLINAHDSQIACFTLTLDGLLLAT
ASVKGTLIRIFNTMDGSRLQEVRRGVDRAEINSIALSPNVQWLAASSDRGTVHVFSLRVRVSGEDSLTQPNAFQGPALFH
QNSSSSLDPLISPNTGANPNSSLSFMRGVLPKYFSSEWSFAQFHLPEYTHFIVAFGSQNSVIIVGMDGSFYRCSFDQVHG
GEVVQQEYVRFLKFENRPK*

DNA
ATGCTGGCTGGTGCCCCGTCTTCTCATATGAGTTCATCTGTCTCAACATCTCAAGGAATATTTCCAACTTCAAGAATTGG
AAGTGGTGAATCCCCCAATAGTGGGGCCTCTTCTTTTACCCAGCCTATTGCAGATATGAATGAAAATGACGAAACAGACT
TGCTCTCAATATCATGGAATCAGGACTATGGTTGCTTTGCTGCTGGCACAAGTCATGGTTTTCGTATCTATAATTGTGAA
CCTTGCAAAGAAACTTTCAGACGTGATTTAAAAAGCGGTGGTTTTAAAATTGTAGAGATGCTGTTCCGCTGCAATATTCT
AGCACTTGTTGGTGCTGTAGCTAATTCTCACTATCCACCAAATAAAGTTTTGATATGGGATGATCATCAGAGCAGGTGCA
TTGGTGAATTTACATTTAGGTCTGATGTTCGTGGAGTGAAATTAAGACGTGATCGAATTGTAGTTGTTCTTGAGCACAAG
ATATATGTTTATAACTTCACAGATTTGAAGCTTCTTCATCAGATTGAGACTCTGGCAAATCCTAGAGGGTTGTGCTGTCT
TTCACACCATTCAAATACATTTGTTTTGGCTTGTCCAGGTCTTCACAAAGGACACGTTCGAGTTGAACACTTCGGACTGA
ACGTGACAAAATTGATCAATGCTCATGATTCTCAAATTGCATGCTTCACTCTGACATTGGATGGGCTCCTTCTTGCAACT
GCTAGTGTGAAGGGCACTTTAATTAGAATCTTCAATACAATGGATGGGTCTCGTTTACAAGAAGTAAGAAGAGGGGTAGA
TAGAGCTGAAATCAACAGTATAGCTTTGTCTCCAAATGTCCAGTGGTTGGCAGCATCAAGTGACAGAGGCACTGTTCATG
TATTCAGCTTGAGAGTGAGAGTGTCTGGGGAGGATAGTTTGACTCAGCCAAATGCTTTTCAAGGGCCTGCACTGTTTCAT
CAGAATTCTTCATCTTCTTTAGATCCCTTGATTTCTCCAAATACTGGTGCTAACCCCAATTCATCATTATCTTTCATGAG
AGGAGTTTTACCAAAATATTTTAGCTCAGAATGGTCATTTGCCCAGTTCCACTTGCCTGAATACACTCATTTCATTGTGG
CATTTGGATCTCAGAACTCTGTGATAATTGTTGGTATGGATGGGAGTTTCTATAGATGCAGCTTTGATCAAGTACATGGG
GGAGAGGTGGTGCAGCAGGAGTATGTTCGTTTCTTAAAATTTGAAAATAGGCCCAAATAA