Details for Soybean Locus Glyma.04G223900

Position : Chr04 ( 5`- 49445698 .. 49450560 -3` )
Annotation :
External links : CoGe
PGDD synteny : Glyma.04G223900

Protein [Map View]
MSRITQFRALLLRGTTNQRSPLRRPAVADSSFASKPSFSNAAAFRASSPVFHPQQRLGNSTFRFFSSNFDKGFAQKVFDK
PAAAVTSAFSRYREAIGLQIEAFFKRNTLFLWGAGGVVLCAFLWRILFGIANLFVGLSEGMAKYGFLALSSAIVAFTGLY
IRARLTINPDKAYRMAMTKLNTSAGILEVMGAPLSGTDLRAYVMSGGGLTVKKFKPSVRGRRCFLIFPIRGSEKKGLVSV
EVKKKKGQYHMKLLAVDVPMASGPDQRLYLIGNEEEYRVGGGIISELRDPVVRAMAATKEFDDLDEIEEEEDAERERQEA
ERKEHEEIEKLEKSSGT*

DNA
ATGTCAAGAATCACCCAATTCCGAGCTCTACTACTCCGCGGCACCACCAACCAGCGCTCCCCTCTCCGCCGCCCCGCCGT
CGCCGATTCTTCATTTGCATCAAAACCCTCATTCTCTAATGCCGCCGCGTTCCGCGCCTCTTCGCCTGTGTTCCACCCGC
AACAACGCCTCGGCAATAGCACCTTCCGATTCTTCTCATCCAATTTCGACAAAGGCTTTGCGCAGAAGGTATTTGATAAA
CCGGCCGCCGCGGTGACCTCGGCCTTCTCGCGTTACCGCGAGGCAATTGGGCTGCAAATCGAGGCGTTCTTCAAGAGGAA
TACTCTCTTTCTGTGGGGCGCCGGTGGCGTTGTCCTCTGCGCTTTTCTGTGGAGGATCCTTTTCGGGATCGCTAACCTCT
TCGTTGGACTCTCCGAAGGCATGGCCAAGTATGGCTTCCTTGCCCTTTCATCTGCTATCGTTGCTTTTACTGGCTTGTAT
ATCCGTGCGAGGCTCACGATCAACCCGGATAAAGCCTATAGAATGGCCATGACGAAACTTAACACGTCGGCTGGGATTCT
TGAAGTTATGGGTGCCCCTCTTTCTGGAACTGATTTGAGAGCCTATGTCATGTCAGGGGGTGGGCTCACTGTAAAGAAGT
TCAAGCCAAGTGTTAGGGGCCGACGGTGTTTTCTCATTTTCCCCATAAGAGGGTCTGAGAAAAAGGGTCTAGTCAGTGTT
GAAGTCAAGAAAAAGAAGGGCCAGTATCATATGAAGCTGCTGGCTGTTGATGTTCCCATGGCTTCTGGTCCAGACCAGCG
GTTGTATCTAATTGGGAATGAAGAAGAGTACAGGGTCGGTGGGGGGATAATATCTGAGCTAAGAGACCCTGTAGTGAGAG
CAATGGCAGCAACCAAGGAATTTGATGATCTTGATGAGATTGAGGAAGAGGAAGATGCTGAAAGAGAACGGCAAGAGGCT
GAAAGAAAGGAGCATGAAGAGATTGAAAAGCTTGAAAAGAGTAGTGGCACCTAG