Details for Soybean Locus Glyma.04G223300

Position : Chr04 ( 5`- 49386505 .. 49389183 -3` )
Annotation :
External links : CoGe
PGDD synteny : Glyma.04G223300

Protein [Map View]
MSILFPRSSSATKRKRVIRELVQGRDYATQLKFLLQKPIGPDGSVSAKELVANVLRSFTETLSVLTSSEVAISGDHHRDE
VAQNLVISGEDASQVESIDPRSEGSTESKKGSKDRRGSYKRRKTEQTWTIVAQTTDDNHAWRKYGQKEILNSQFPRSYFR
CTRKFEQGCRATKQVQRIQENPDMYTITYIGFHTCKDTLKAPQMVTHSETWDSFLGPDANDVPNEHDSTIGSQSLIVKQE
YPNDETDPSDLTDANFWSDFKDFELSNDKPAGLKIASENADTVYSCTGSRSLDMDFGIFSSHFCSTEDFHFDESQLL*

DNA
ATGAGTATTCTCTTCCCAAGAAGTTCCTCAGCAACAAAGAGGAAAAGGGTCATTAGAGAACTTGTTCAGGGTCGAGATTA
TGCCACTCAGCTCAAGTTTCTGCTTCAGAAGCCTATTGGCCCTGACGGGTCTGTTTCAGCCAAGGAACTTGTGGCCAATG
TGCTGAGATCTTTCACTGAAACTCTCTCTGTGTTGACTTCTTCCGAGGTTGCAATAAGTGGTGATCATCATCGTGACGAA
GTTGCTCAGAATCTTGTAATTTCCGGAGAAGATGCCTCGCAGGTGGAAAGCATTGATCCGAGGTCTGAGGGTTCAACTGA
GAGTAAGAAGGGATCAAAGGATCGGAGAGGGTCCTATAAAAGAAGGAAGACTGAACAGACATGGACCATAGTTGCCCAAA
CTACTGATGATAATCATGCATGGAGAAAGTACGGACAAAAGGAAATCCTAAATTCTCAATTTCCCAGGAGTTACTTCAGG
TGCACTAGGAAGTTTGAACAAGGTTGCCGAGCAACCAAACAAGTGCAACGGATACAAGAGAATCCTGATATGTACACCAT
TACGTACATTGGCTTTCACACATGCAAAGACACCCTCAAGGCTCCACAAATGGTGACACATTCTGAAACTTGGGACTCAT
TTCTTGGTCCTGACGCAAATGATGTGCCGAATGAACATGATTCCACTATTGGATCACAAAGCCTGATTGTAAAACAAGAA
TATCCCAACGATGAGACTGATCCAAGTGATCTCACAGATGCTAACTTTTGGTCTGATTTCAAGGATTTTGAACTATCCAA
TGACAAGCCTGCAGGTTTGAAAATAGCATCTGAAAATGCAGATACTGTGTATTCATGCACTGGCTCGAGAAGTTTGGACA
TGGATTTTGGGATATTCTCTTCTCATTTCTGCAGCACCGAGGACTTCCACTTTGATGAAAGCCAATTGCTTTAG