Details for Soybean Locus Glyma.04G222800

Position : Chr04 ( 5`- 49330857 .. 49335545 -3` )
Annotation :
External links : CoGe
PGDD synteny : Glyma.04G222800

Protein [Map View]
MQALFSSMRVFLRLVWLLELLCVAVTAVNPSLNDDVLGLIVFKADIRDPKGKLASWNEDDESACGGSWVGVKCNPRSNRV
VEVNLDGFSLSGRIGRGLQRLQFLRKLSLANNNLTGGINPNIARIDNLRVIDLSGNSLSGEVSEDVFRQCGSLRTVSLAR
NRFSGSIPSTLGACSALAAIDLSNNQFSGSVPSRVWSLSALRSLDLSDNLLEGEIPKGIEAMKNLRSVSVARNRLTGNVP
YGFGSCLLLRSIDLGDNSFSGSIPGDFKELTLCGYISLRGNAFSGGVPQWIGEMRGLETLDLSNNGFTGQVPSSIGNLQS
LKMLNFSGNGLTGSLPESMANCTKLLVLDVSRNSMSGWLPLWVFKSDLDKVLVSENVQSGSKKSPLFAMAELAVQSLQVL
DLSHNAFSGEITSAVGGLSSLQVLNLANNSLGGPIPPAVGELKTCSSLDLSYNKLNGSIPWEIGGAVSLKELVLEKNFLN
GKIPTSIENCSLLTTLILSQNKLSGPIPAAVAKLTNLQTVDVSFNNLTGALPKQLANLANLLTFNLSHNNLQGELPAGGF
FNTITPSSVSGNPSLCGAAVNKSCPAVLPKPIVLNPNTSTDTGPSSLPPNLGHKRIILSISALIAIGAAAVIVIGVISIT
VLNLRVRSSTSRDAAALTFSAGDEFSHSPTTDANSGKLVMFSGEPDFSSGAHALLNKDCELGRGGFGAVYQTVLRDGHSV
AIKKLTVSSLVKSQEDFEREVKKLGKIRHQNLVELEGYYWTPSLQLLIYEYLSGGSLYKHLHEGSGGNFLSWNERFNVIL
GTAKALAHLHHSNIIHYNIKSTNVLLDSYGEPKVGDFGLARLLPMLDRYVLSSKIQSALGYMAPEFACKTVKITEKCDVY
GFGVLVLEIVTGKRPVEYMEDDVVVLCDMVRGALEEGRVEECIDERLQGKFPAEEAIPVMKLGLICTSQVPSNRPDMGEV
VNILELIRCPSEGQEELA*

DNA
ATGCAAGCGTTGTTTTCAAGCATGAGAGTTTTTCTTCGTCTTGTGTGGTTGTTGGAGCTGCTTTGCGTGGCGGTTACCGC
CGTGAACCCTTCTCTGAACGACGACGTTTTGGGGCTGATTGTGTTCAAAGCTGACATACGAGATCCAAAGGGGAAGCTCG
CGTCTTGGAACGAGGACGATGAGAGCGCATGTGGGGGTAGTTGGGTTGGGGTGAAGTGCAACCCTAGATCCAATAGAGTG
GTGGAGGTTAACCTTGATGGGTTTTCTCTCTCTGGGAGAATAGGTAGAGGGTTGCAAAGGTTGCAGTTTCTGAGAAAGCT
TTCTCTGGCGAATAACAACCTCACTGGGGGGATAAACCCCAACATTGCTCGAATAGATAACCTTAGGGTCATTGACTTGA
GTGGGAATAGTCTCTCAGGAGAGGTGTCTGAGGATGTTTTCCGACAATGTGGGTCTCTCAGGACTGTTTCCTTGGCCAGG
AACAGGTTTTCTGGGAGCATTCCCTCTACTTTGGGGGCATGTTCTGCTCTTGCTGCTATTGACCTTTCTAATAACCAGTT
TTCTGGTTCTGTTCCCTCTAGGGTTTGGTCTTTGAGTGCTCTCAGGTCTCTGGATTTGTCTGATAACTTGTTGGAGGGAG
AGATTCCTAAGGGGATTGAGGCGATGAAGAATTTAAGGAGTGTTAGCGTGGCGAGGAACCGGTTGACTGGGAATGTTCCT
TATGGGTTTGGAAGTTGTTTGCTTTTGAGGTCCATTGATTTAGGGGACAATTCTTTTTCTGGGAGTATTCCTGGTGATTT
TAAGGAACTTACATTGTGTGGTTACATTAGCTTGCGCGGGAATGCTTTCTCGGGAGGGGTTCCTCAGTGGATTGGGGAGA
TGAGAGGGCTTGAGACGTTGGACCTTTCAAACAATGGGTTTACCGGTCAGGTGCCAAGCTCTATTGGAAATCTTCAGTCG
TTGAAGATGCTGAATTTTTCTGGAAATGGTCTCACTGGTAGTCTGCCGGAGTCTATGGCAAATTGTACGAAACTTTTGGT
GTTGGATGTCAGCCGGAACTCAATGTCGGGGTGGCTTCCGTTGTGGGTTTTCAAGTCAGATTTGGACAAGGTTTTGGTGT
CAGAAAATGTACAGAGTGGGAGCAAGAAAAGCCCTTTGTTTGCCATGGCTGAACTTGCCGTTCAAAGTCTTCAAGTTTTG
GATTTGTCTCACAATGCATTTTCTGGTGAAATCACGTCTGCTGTTGGAGGGTTAAGCAGCTTGCAGGTTTTGAATTTGGC
AAATAACTCTCTGGGAGGTCCTATACCACCTGCCGTTGGTGAGTTGAAAACATGTTCGAGTCTTGATTTGAGCTATAATA
AGCTGAATGGAAGCATACCCTGGGAAATAGGAGGAGCTGTGTCCTTGAAAGAACTTGTACTGGAAAAGAACTTCCTAAAT
GGGAAAATTCCAACGTCAATTGAGAACTGCTCTTTGCTAACAACTTTGATTCTGTCACAGAACAAGCTGAGTGGTCCAAT
ACCTGCAGCAGTTGCAAAACTTACCAACCTACAAACTGTGGATGTATCGTTTAACAATCTTACTGGAGCCCTTCCTAAGC
AATTGGCTAACCTTGCCAATCTTCTTACCTTCAATTTATCTCATAACAACCTTCAGGGTGAACTGCCGGCTGGTGGTTTT
TTCAACACCATTACGCCTTCCTCTGTTTCTGGCAATCCATCTCTTTGTGGCGCTGCAGTAAACAAATCATGCCCTGCTGT
TCTCCCAAAGCCTATTGTTCTAAATCCCAACACTTCTACTGACACCGGCCCTAGTTCATTGCCTCCAAATTTGGGTCACA
AAAGAATCATTCTCAGCATTTCTGCACTCATTGCCATTGGTGCAGCAGCTGTCATTGTAATTGGTGTTATAAGCATCACA
GTTCTCAATCTCCGTGTTCGCTCCTCTACATCTCGTGATGCAGCTGCCCTCACATTTTCTGCAGGGGACGAATTCAGCCA
TTCCCCAACTACAGATGCTAACTCTGGCAAGCTTGTCATGTTTTCAGGTGAGCCTGATTTCAGTTCTGGTGCTCATGCTT
TGCTTAATAAGGATTGTGAGCTTGGACGTGGAGGATTTGGAGCAGTGTACCAAACAGTTCTTAGAGATGGACATTCAGTT
GCCATAAAGAAGCTCACAGTATCAAGCCTTGTCAAGTCTCAAGAAGATTTTGAAAGAGAAGTGAAGAAATTAGGAAAAAT
CAGACACCAAAACCTCGTTGAACTTGAGGGTTATTATTGGACTCCATCACTGCAGCTCCTCATATATGAGTATCTCTCTG
GTGGTAGTCTCTATAAGCATCTCCATGAAGGATCTGGTGGAAATTTCCTCTCATGGAACGAGAGGTTTAATGTGATTCTC
GGAACCGCAAAGGCCTTGGCACACTTGCACCATTCCAACATTATTCACTATAACATTAAGTCAACCAACGTCCTTCTTGA
TAGTTATGGTGAACCAAAAGTAGGGGACTTTGGCCTGGCAAGACTGCTGCCAATGCTTGATCGATACGTTTTGAGCAGCA
AAATTCAAAGCGCACTCGGCTACATGGCACCAGAGTTTGCCTGCAAGACGGTGAAAATCACCGAGAAATGTGATGTATAT
GGGTTCGGTGTCTTGGTCTTGGAGATTGTTACAGGGAAGAGGCCGGTTGAATACATGGAGGATGATGTGGTGGTACTTTG
CGACATGGTGAGAGGGGCTTTGGAAGAGGGCAGGGTGGAGGAATGCATTGATGAGAGGCTCCAAGGGAAGTTCCCAGCAG
AAGAAGCTATTCCTGTGATGAAGTTAGGCTTAATATGTACTTCTCAGGTGCCATCTAACAGGCCTGACATGGGAGAGGTA
GTTAACATATTGGAGCTGATAAGATGTCCCTCTGAAGGACAAGAAGAATTGGCATGA