Details for Soybean Locus Glyma.04G222500

Position : Chr04 ( 5`- 49310767 .. 49312445 -3` )
Annotation :
External links : CoGe
PGDD synteny : Glyma.04G222500

Protein [Map View]
MASSLAIACGGNNNANLGMQKQRCARVLQPPCSVSMGRSTARAGRITAAMPTVKEQETTPMIMMGAMELLGKRERGGAKN
DALEGQERLDRWMRESVVEIVKNLKEAPLLVLVFPKSATMATEKRVVVEDWPAVKERWESGETPVPEGLIFVEELDGDTA
EDGGGERTTRAWGVVVQGKGVGCGPVCYLLKTCRVGSGPGNGMGICSTHFCLVKVNDFRETVQSQLKNIWLLQNQCQWNN
Y*

DNA
ATGGCGTCGTCTCTGGCCATTGCTTGCGGCGGAAACAACAACGCCAACTTAGGGATGCAGAAGCAGCGGTGCGCTCGGGT
TCTCCAGCCGCCGTGCTCCGTCTCGATGGGCCGGTCTACGGCGAGGGCCGGGAGGATCACGGCGGCGATGCCGACGGTGA
AGGAGCAAGAGACTACTCCGATGATCATGATGGGGGCAATGGAGCTGCTCGGGAAGCGCGAGCGAGGAGGAGCGAAAAAC
GACGCCCTCGAGGGACAGGAGAGGCTGGACAGGTGGATGAGAGAGTCGGTGGTGGAGATCGTGAAGAATTTGAAGGAGGC
GCCGCTGCTGGTGCTGGTTTTTCCCAAATCGGCGACGATGGCGACGGAGAAGAGGGTGGTGGTGGAGGACTGGCCGGCGG
TGAAGGAGCGGTGGGAATCCGGCGAGACGCCGGTTCCGGAGGGATTGATATTCGTGGAGGAGTTGGACGGGGACACGGCG
GAGGACGGTGGCGGAGAGAGGACGACGAGGGCGTGGGGGGTGGTGGTTCAGGGGAAGGGCGTCGGGTGCGGTCCGGTTTG
TTATCTTTTAAAGACTTGTCGGGTCGGGTCAGGACCCGGTAATGGGATGGGGATTTGTTCGACCCATTTTTGCTTGGTGA
AAGTGAACGACTTCAGGGAAACGGTTCAGTCGCAGCTCAAGAATATTTGGCTTTTGCAGAACCAGTGCCAGTGGAATAAC
TATTAA