Details for Soybean Locus Glyma.02G236200

Position : Chr02 ( 5`- 42368655 .. 42371620 -3` )
Annotation :
External links : CoGe
PGDD synteny : Glyma.02G236200

Protein [Map View]
MQDPSSNPNSNPNPNPHNANAASQLPRPPQATASTAVAGAFSSSLFARSGGPHHRRAHSEMSFRLPDDMMDLSPSDPFAG
GSSTASMEEIGSEDDLFSTYIDVDKLSGANGSGGAGNGADPTGEREKSPARPRHRQSSSVDFGEIMDAKKAMPPDKLAEL
WTIDPKRAKRILANRQSAARSKERKARYIQELERKVQTLQTEATTLSAQLTLYQRDTSGLSTENTELKLRLQAMEQQAQL
RDALNEALKKEVERLKVATGEGMSHTESFNLGMHQMPFSGSNFIPIPPQSGPSGHQNMQMPPFGHSPSTMPTHQLHQTSS
HPYSEILQNEQLGRFQGLDISSKGSTLVKSEGPSLSASESSSTF*

DNA
ATGCAAGATCCATCTTCAAACCCTAATTCCAATCCAAATCCCAATCCTCACAACGCCAATGCCGCATCCCAGTTACCGCG
TCCGCCGCAGGCCACGGCGTCCACCGCCGTCGCCGGCGCCTTCTCGTCCTCTCTATTCGCGCGCTCCGGCGGACCTCACC
ACCGGCGAGCCCACTCGGAGATGAGTTTCCGGCTGCCGGACGATATGATGGACCTCTCGCCGTCGGATCCGTTCGCCGGC
GGGTCATCGACGGCGAGCATGGAGGAGATCGGATCGGAGGACGACCTGTTCTCGACGTACATTGACGTGGACAAGCTCAG
TGGCGCGAACGGGTCGGGCGGTGCCGGAAACGGAGCGGATCCGACCGGCGAACGCGAGAAGAGTCCGGCGAGGCCGCGTC
ACCGGCAAAGTAGCTCCGTCGATTTCGGGGAAATCATGGATGCGAAGAAAGCTATGCCTCCTGATAAGTTAGCTGAGCTA
TGGACAATTGATCCCAAGCGTGCTAAGAGAATACTTGCAAATCGGCAATCTGCTGCTCGATCAAAGGAGAGAAAAGCGCG
CTATATACAAGAACTTGAGCGCAAGGTTCAGACTCTTCAGACGGAAGCCACAACTCTTTCTGCCCAATTGACATTATACC
AGAGGGACACATCTGGCCTTAGTACTGAAAATACAGAGCTTAAGCTCCGTCTGCAAGCCATGGAGCAACAAGCACAGCTT
CGCGATGCTCTTAATGAAGCATTGAAGAAGGAAGTTGAGAGACTTAAGGTTGCTACCGGTGAGGGGATGAGCCACACTGA
ATCCTTTAATCTGGGAATGCACCAGATGCCATTTTCCGGATCAAATTTCATTCCAATCCCGCCACAATCAGGTCCTTCTG
GTCACCAGAACATGCAGATGCCACCATTTGGTCACTCCCCATCCACAATGCCAACTCATCAACTGCATCAAACAAGTTCT
CATCCATATTCAGAAATATTGCAAAATGAACAGCTTGGTCGTTTCCAAGGGCTTGACATTAGTAGCAAAGGATCAACTCT
CGTGAAGTCTGAAGGCCCCTCGCTCTCTGCAAGTGAGAGTAGCAGTACATTTTGA