Details for Soybean Locus Glyma.02G235900

Position : Chr02 ( 5`- 42337774 .. 42340911 -3` )
Annotation :
External links : CoGe
PGDD synteny : Glyma.02G235900

Protein [Map View]
MAPHASSFALVLLIFLFVEMHFHGATADYGGWQGGHATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTALFNNGLS
CGACYAMKCDDDPRWCKPGTIIVTATNFCPPNFALANNNGGWCNPPLQHFDMAEPAFLQIAQYRAGIVPVAFRRVSCVKR
GGIRFTINGHSYFNLVLITNVAGAGDVHAVSIKGSRTSWQPMSRNWGQNWQSNSYLNGQSLSFQVTASDGRTVTSFNVAP
SNWQFGQTFQGGQF*

DNA
ATGGCACCCCATGCATCTTCTTTTGCTCTAGTTCTTCTCATTTTTCTCTTTGTTGAAATGCACTTCCATGGTGCCACTGC
TGACTATGGCGGTTGGCAGGGTGGTCATGCTACTTTCTATGGTGGTGGTGATGCTTCTGGAACAATGGGAGGTGCATGTG
GCTATGGGAATTTGTACAGTCAGGGATATGGAACCAACACTGCAGCTCTAAGCACTGCTTTGTTCAACAATGGCTTGAGT
TGTGGGGCATGTTATGCAATGAAGTGTGATGATGACCCAAGATGGTGCAAGCCTGGCACCATAATTGTCACTGCTACAAA
CTTCTGTCCTCCAAACTTTGCTTTGGCCAACAATAATGGTGGTTGGTGCAACCCTCCTCTACAACACTTTGATATGGCAG
AACCAGCATTCCTTCAAATTGCTCAGTATAGAGCTGGAATTGTGCCTGTGGCATTTAGAAGAGTGTCCTGTGTGAAAAGG
GGGGGAATAAGGTTCACAATAAATGGCCACTCTTACTTCAACCTGGTTTTGATCACCAACGTCGCGGGTGCAGGGGATGT
TCATGCAGTGTCAATCAAAGGGTCCAGAACTAGTTGGCAACCCATGTCAAGAAACTGGGGGCAAAATTGGCAGAGCAACT
CCTACCTCAATGGACAAAGCCTCTCTTTTCAAGTCACCGCAAGTGACGGTAGAACTGTCACAAGCTTCAACGTGGCACCA
TCTAACTGGCAGTTCGGTCAGACCTTCCAAGGGGGTCAGTTTTAG