Details for Soybean Locus Glyma.02G235800

Position : Chr02 ( 5`- 42321668 .. 42331137 -3` )
Annotation :
External links : CoGe
PGDD synteny : Glyma.02G235800

Protein [Map View]
MGDLHVNGVVFGEDRPCASSPPSPPLPPWNPDPSSVAADAWAAAERNTAEILRRIRPTLAADRRRREVVDYVQRLIRYGA
RCEVFPYGSVPLKTYLPDGDIDLTALSCENIEDGLVSDVRAVLHGEEINEAAEYEVKDVRFIDAEVKLVKCIVQDIVVDI
SFNQLGGLSTLCFLEKVDRLVAKDHLFKRSIILIKAWCYYESRVLGAHHGLISTYALETLVLYIFHQFHVSLDGPLAVLY
RFLDYFSKFDWDNYCVSLKGPVSKTSLPNIVAEVPENGGNTLLTEEFIRSCVESFSVPSRGADLNLRAFPQKHLNIIDPL
KENNNLGRSVNKGNFYRIRSAFKYGARKLGWILRLPEDRIAEELIRFFANTLERHGSTQGNVDKSFLSLSTASGKDRKPG
NQHNFESRDERERYVVQDAGEFFDSSRDGNAVTSFKLGEDSKDIATSGVLDRTSTNGWSYCSNEQFENNISDSEPALNSV
INDEKEKQVMAGNSPRSHTDEKHMAVSEASKSLLDLTGDYDSHIGNLQYGHMCNGYPVSLVVPSPPRSPKFPNRNPWETV
HQCVPINHSIRSQANSNCVMGQQVYVINHPTLPMTSFGSEEKRKVRGTGAYFPNMTSRPYRDNRPIPGRGRGQAPGTHGH
LQRHSRNNGFALAPQETNLSVDGTFEHALEGYSGFGSTKTRSSETYFPQPSTWGSHYANGFLHSSEKPESGPASPQLRVV
PRNEMSNYPESGISTPRDTVPNTEEVTEEKSDSLSAVDSKSVFGGVHGHSNCRDDAPEKHAW*

DNA
ATGGGCGATCTTCATGTGAACGGCGTCGTTTTCGGGGAGGATCGCCCCTGCGCGTCCTCGCCGCCGTCGCCGCCGCTTCC
GCCTTGGAATCCCGATCCATCCTCCGTCGCGGCCGACGCCTGGGCGGCGGCCGAGAGAAACACCGCTGAGATTCTCCGCC
GCATACGGCCCACGCTCGCCGCCGACCGCAGGCGCAGGGAGGTCGTCGATTACGTACAGAGACTCATCCGGTACGGCGCG
CGCTGCGAGGTTTTTCCATATGGGTCAGTTCCGTTAAAAACATATCTTCCAGACGGAGATATTGATTTGACTGCACTCAG
CTGTGAAAACATTGAGGATGGCCTGGTATCTGATGTTCGTGCTGTTCTTCATGGAGAGGAAATCAATGAAGCTGCTGAAT
ATGAAGTAAAGGATGTTCGTTTCATTGATGCAGAGGTTAAGCTTGTTAAATGCATTGTACAGGATATTGTTGTAGACATC
TCTTTCAATCAGTTAGGAGGACTCAGTACATTATGTTTTCTTGAGAAGGTTGATCGACTTGTTGCCAAGGATCATCTCTT
CAAACGTAGTATTATCCTTATTAAAGCTTGGTGCTACTACGAGAGCCGTGTACTGGGTGCCCATCATGGTCTGATTTCAA
CATATGCTTTGGAAACACTGGTTCTGTATATTTTCCATCAGTTTCATGTATCCTTAGATGGTCCTCTAGCAGTTCTCTAC
AGATTTTTGGACTACTTCAGCAAATTTGATTGGGACAATTATTGTGTTAGTTTGAAGGGACCAGTCAGTAAAACTTCTCT
GCCTAATATAGTAGCTGAGGTGCCTGAAAATGGAGGGAATACATTACTGACTGAAGAATTCATTAGAAGCTGTGTGGAGT
CATTCTCAGTACCATCAAGGGGGGCTGATTTAAATTTGCGTGCATTTCCCCAGAAACATCTTAACATCATTGATCCTTTG
AAAGAAAACAACAATCTTGGCCGCAGTGTCAATAAAGGTAATTTCTATCGAATACGCAGTGCTTTTAAGTATGGTGCCCG
TAAACTTGGCTGGATTCTTAGGTTACCAGAAGACAGAATAGCTGAGGAGCTTATTAGGTTCTTTGCAAACACTCTGGAAA
GGCATGGAAGCACTCAGGGGAATGTAGACAAGTCATTTTTGAGCTTATCTACAGCTTCCGGAAAGGATAGGAAACCTGGA
AATCAACATAATTTTGAAAGCAGAGATGAAAGAGAAAGATATGTAGTACAAGATGCAGGGGAGTTCTTTGACTCCTCTAG
GGATGGAAATGCAGTTACAAGTTTTAAACTTGGTGAAGATTCTAAGGATATTGCAACATCTGGGGTCTTGGATCGCACAA
GCACTAATGGTTGGTCTTATTGTTCAAATGAGCAATTTGAAAATAATATTTCTGATAGTGAACCTGCCCTAAATTCTGTT
ATCAATGATGAGAAAGAGAAGCAAGTTATGGCAGGCAATTCACCCAGATCACATACCGATGAAAAGCATATGGCAGTCTC
CGAAGCTTCAAAGTCATTGTTGGACCTTACTGGGGATTATGACAGTCACATTGGGAACTTACAATATGGTCATATGTGTA
ATGGTTATCCTGTCTCTCTCGTTGTGCCTAGTCCTCCTAGGTCTCCGAAGTTTCCAAATAGGAATCCATGGGAAACTGTT
CATCAATGTGTACCGATTAATCACAGTATTCGTTCTCAGGCAAACTCAAATTGTGTAATGGGACAACAAGTTTACGTCAT
AAATCATCCTACTCTGCCAATGACTTCTTTTGGTTCAGAAGAGAAGAGAAAAGTACGAGGAACAGGCGCATACTTCCCGA
ATATGACTTCCCGTCCTTACAGGGACAATAGGCCAATACCAGGAAGGGGAAGGGGTCAAGCACCAGGTACTCATGGACAT
CTGCAGAGACACAGCCGTAACAATGGCTTTGCCCTAGCTCCACAAGAGACAAATTTGTCTGTGGATGGAACTTTTGAACA
TGCTCTAGAAGGATATTCTGGTTTTGGTAGTACCAAAACCAGATCATCTGAAACCTATTTCCCTCAACCTTCTACATGGG
GATCACATTATGCTAATGGTTTCCTTCATTCATCTGAGAAACCTGAATCTGGACCTGCAAGCCCTCAGCTTCGAGTAGTG
CCAAGAAATGAAATGAGCAATTACCCAGAGTCAGGCATTTCTACTCCTAGGGACACTGTGCCTAACACTGAGGAGGTGAC
AGAGGAGAAGTCTGATTCATTGTCAGCAGTTGATTCCAAAAGTGTCTTTGGTGGAGTCCATGGCCATTCAAATTGCCGTG
ATGATGCCCCCGAGAAACATGCGTGGTAG