Details for Grape vine Locus GSVIVT01032670001

Position : chr13 ( 5`- 1645352 .. 1641324 -3` )
Annotation :
External links : CoGe
PGDD synteny : GSVIVT01032670001

Protein [Map View]
MAYLLGVLLALLVVAPSCVKSLNPSLNDDVLGLIVFKADIQDPNSKLASWNEDDDSPCNWVGVKCNPRSNRVTDLVLDGF
SLSGKIGRGLLQLHVGSCSTLAAIDFSSNQFSGPLPSGIWSLNGLRSLDLSDNLLEGDIPKGIDSLYNLRAINLSKNRFS
GPLPDGIGGCLLLRLIDFSENSLSGSLPGTMQKLTLCNYMNLHGNSFEGEVPEWIGEMKSLETLDLSANKFSGRVPTSIG
NLKSLKLLFLNISRNSLVGAIPASIGDLKALDVLDLSENQLNGSIPLEIGGAFSLKDLRLKNNFLAGKIPVSLENCSSLT
TLILSHNNLSGPIPMGISKLSNLENVDLSLNKLTGSLPKQLANLPHLISFNISHNQLQGELPAGGFFNTISPSSVSGNPS
LCGSAANKSCPAVLPKPIVLNPNSSSDTTAGAFPRSLAHKKIILSISALIAIGAAAVIVIGVIAITVLNLRVRSSASRSA
AALALSGGDDYSHSPTTDANSGKLVMFSGDPDFSMGAHALLNKDCELGRGGFGAVYRTVLRDGHPVAIKKLTVSSLVKSQ
EDFEREVKKLGKIRHQNLVALEGYYWTPSLQLLIYEFISGGSFLAHLHQMSIIHYNLKSSNVLIDPSGEPKVADFGLARL
LPMLDRYVLSSKIQSALGYMAPEFACRTVKITEKCDVYGFGVLVLEVVTGKRPVEYMEDDVVVLCDMVRGALEEGKVEEC
VDGRLQGKFPAEEAIPVMKLGLICTSQVPSNRPDMAEVVNILELIRCPSEGQEDLSAPIGVESICSLTLYIFFQQKRQCN
PRIKIPVLLVFFPSDGRAELGSTLLIKNGCPIYQKQLSLMIQKLKAC*

DNA
ATGGCGTATCTACTCGGTGTATTGTTAGCTTTGCTCGTTGTGGCTCCGAGTTGTGTGAAATCTCTGAACCCATCTCTGAA
TGATGATGTTCTGGGCTTGATTGTGTTCAAGGCCGATATTCAAGATCCAAATTCGAAGTTGGCATCTTGGAATGAAGATG
ATGATAGTCCCTGCAACTGGGTTGGGGTCAAATGCAACCCCAGATCCAACCGGGTCACCGACCTCGTTCTCGACGGTTTT
TCCCTTTCGGGGAAGATAGGCAGAGGCCTACTCCAGTTACATGTAGGTTCATGTTCAACGCTTGCTGCAATTGACTTCTC
CTCTAATCAGTTTTCGGGTCCATTACCTTCTGGCATTTGGTCTTTGAACGGGCTTAGATCACTTGATTTGTCGGATAACT
TGTTGGAGGGCGATATACCAAAGGGGATTGACAGTTTGTACAATTTGAGAGCTATTAACTTGAGCAAGAATCGGTTTTCT
GGGCCGCTTCCAGATGGCATTGGAGGTTGTTTGCTTTTACGGTTAATTGATTTCAGTGAGAATTCTCTTTCTGGGAGCCT
TCCAGGGACAATGCAGAAACTTACCTTGTGTAATTATATGAATTTACACGGGAATTCGTTTGAGGGCGAGGTTCCGGAGT
GGATTGGAGAAATGAAAAGCCTGGAGACTTTGGATCTCTCAGCCAATAAATTTTCTGGCAGGGTTCCAACATCAATAGGG
AATCTCAAGTCGTTGAAGCTTTTGTTCTTGAATATTTCCAGGAACTCCCTCGTGGGTGCTATTCCAGCAAGTATTGGAGA
TCTAAAGGCCTTAGATGTTCTTGATTTGAGTGAGAACCAGCTAAATGGAAGCATTCCTCTGGAAATTGGAGGAGCCTTTT
CTTTGAAGGATCTGAGATTGAAGAACAACTTCCTAGCTGGAAAAATTCCTGTTTCTCTTGAGAACTGTTCTTCATTAACG
ACATTGATCCTATCACATAACAATCTGAGTGGCCCAATACCAATGGGGATTTCAAAGCTTAGCAACCTAGAAAATGTGGA
TTTATCTCTTAACAAGCTCACAGGAAGCCTGCCCAAGCAGTTGGCCAATCTTCCACACCTCATCTCCTTCAACATTTCCC
ACAATCAGCTCCAAGGTGAACTACCTGCTGGTGGCTTTTTCAACACCATTTCCCCTTCCTCTGTCTCTGGCAATCCATCT
CTTTGTGGCTCTGCTGCGAATAAGTCTTGCCCTGCTGTACTTCCCAAGCCCATTGTCCTTAACCCCAATTCTTCCTCTGA
CACCACTGCGGGTGCATTCCCTCGAAGTCTTGCTCACAAGAAAATCATCCTCAGCATTTCTGCACTCATTGCCATTGGTG
CTGCTGCTGTCATTGTAATTGGTGTGATTGCCATCACCGTTCTTAATCTCCGCGTCCGATCTTCTGCATCTCGTTCTGCA
GCAGCTCTTGCGCTATCTGGTGGTGATGACTACAGCCATTCCCCTACTACAGATGCCAACTCTGGCAAACTTGTCATGTT
TTCGGGTGACCCTGACTTCAGCATGGGAGCACATGCTCTGCTCAACAAGGATTGTGAGCTCGGGCGAGGGGGGTTTGGAG
CAGTCTACCGGACTGTTCTTCGAGATGGTCATCCAGTTGCCATCAAGAAGCTTACTGTCTCAAGTCTGGTCAAGTCCCAA
GAAGATTTTGAAAGGGAAGTTAAGAAACTGGGAAAGATCCGGCACCAGAATCTTGTGGCACTTGAAGGGTATTACTGGAC
TCCATCATTACAGCTCCTAATATATGAATTCATCTCTGGTGGAAGTTTCTTGGCTCACTTGCACCAAATGAGCATAATCC
ATTACAATCTAAAATCAAGTAACGTCCTCATCGACCCCTCAGGCGAACCTAAGGTGGCAGATTTTGGCCTAGCCAGGCTG
TTGCCAATGCTAGATCGATACGTTCTAAGCAGCAAGATTCAGAGTGCACTAGGCTACATGGCACCTGAGTTTGCATGCAG
GACAGTGAAGATAACTGAGAAGTGCGACGTTTATGGGTTCGGGGTTTTGGTTCTGGAAGTGGTTACTGGGAAGAGGCCAG
TCGAATACATGGAGGATGATGTGGTGGTGCTCTGTGATATGGTCAGAGGAGCATTGGAAGAAGGTAAGGTGGAGGAATGT
GTTGATGGGAGACTCCAAGGAAAATTCCCAGCTGAGGAGGCAATTCCTGTGATGAAGTTAGGCTTAATTTGCACTTCACA
GGTGCCATCAAATCGGCCAGACATGGCAGAGGTGGTAAATATATTGGAACTGATCAGATGCCCTTCAGAAGGTCAAGAGG
ACCTCTCAGCTCCAATTGGTGTTGAATCTATCTGCTCATTGACTCTATATATCTTCTTCCAGCAGAAAAGACAATGTAAT
CCAAGAATAAAAATCCCTGTTTTACTTGTATTTTTCCCAAGTGATGGAAGGGCAGAGTTGGGTTCAACACTCCTGATTAA
GAATGGTTGTCCTATTTACCAAAAACAGTTGTCTCTAATGATACAAAAGTTGAAGGCATGTTAG