Details for Grape vine Locus GSVIVT01032662001

Position : chr13 ( 5`- 1716836 .. 1718836 -3` )
Annotation :
External links : CoGe
PGDD synteny : GSVIVT01032662001

Protein [Map View]
MEETLSHIVRGCKLARELESNIPNLAKQPRMLAKSCDEIMKIFGTAKERLNAQDDHSAYPYMFAQASGMETSGEMQEWLK
TSYLQALQAQYGLTESKVGGIEPVTLSGHPGFELGGRDREGSARSTGSGGEFQAMEGSDSGNSNSQRLRRRKDDIRKRKE
TVAAPRIGNTDIPPDDNFTWRKYGQKEILGSKYPRSYYRCTHQKLYNCPAKKQVQRLEHDPFMFDITYIDDHTCHKSATA
PSGSSSSMVGTGGSTAGPSMVRFGREAEYPVVDLADTMFNSGSSSSNSMDFLFTHTEEKWEPAGDKKN*

DNA
ATGGAGGAGACCCTTTCTCATATTGTTCGAGGGTGCAAGTTGGCTAGAGAGCTTGAATCAAACATCCCGAACCTCGCCAA
GCAGCCCAGGATGCTGGCCAAGTCCTGTGATGAGATCATGAAGATTTTCGGGACTGCGAAGGAGAGGCTGAATGCTCAGG
ATGACCACTCGGCATATCCCTACATGTTTGCGCAGGCCTCGGGGATGGAGACCAGTGGGGAAATGCAGGAATGGCTGAAG
ACAAGCTACCTGCAAGCGCTCCAAGCACAGTATGGCTTGACAGAGAGCAAGGTAGGTGGGATCGAACCTGTGACCTTGTC
GGGTCATCCTGGTTTTGAGCTGGGTGGACGGGATAGGGAAGGCTCAGCCAGATCAACAGGCAGCGGAGGAGAGTTTCAGG
CAATGGAAGGATCAGATTCCGGGAATAGTAATTCGCAAAGATTACGAAGAAGAAAGGATGATATAAGGAAAAGGAAGGAG
ACAGTAGCAGCGCCTAGAATTGGGAACACTGATATTCCTCCGGATGACAATTTTACTTGGAGAAAATATGGGCAAAAGGA
GATCCTGGGATCAAAGTACCCAAGGAGTTACTATAGATGCACCCACCAGAAACTATACAACTGTCCAGCCAAGAAACAAG
TACAGCGGCTCGAACATGATCCCTTCATGTTTGATATAACTTATATAGATGATCACACCTGCCACAAGTCTGCCACAGCT
CCTTCAGGAAGCAGCAGCAGCATGGTTGGCACTGGGGGAAGTACTGCAGGTCCTTCCATGGTTCGATTCGGGCGAGAAGC
GGAATATCCAGTGGTGGATCTCGCTGATACAATGTTCAATTCTGGTAGCAGTAGTAGCAATAGCATGGACTTCCTCTTCA
CTCACACGGAGGAAAAATGGGAGCCGGCTGGTGACAAGAAAAACTGA