Details for Grape vine Locus GSVIVT01032655001

Position : chr13 ( 5`- 1789660 .. 1785126 -3` )
Annotation :
External links : CoGe
PGDD synteny : GSVIVT01032655001

Protein [Map View]
MISGPATKIRLVRCPKCWKLLPEVAGIPLYQCGGCGVFLRAKNHGNSTKTTPSGSHETGSVQRNELVHVSENEESSSSSR
EAIPSSTGECSLNKENGRDDLGDCRTEQPEVNFSNGVSSTTKQPEDANFSDKVPSSINLSNEVSSLMKHFEDVNISDEGS
SSKVQPEEVNFSNEVSSPMEQPEDANISDEGSSSKVQPEDVNFSNEVSSPMVQPEDVNISNEGSSSNVHPEDVNSSNEVS
SPMEQQPEDVNISNEGSSSNVQPKDVNFSNEVSSPMEQQPEDVNISNEGSSSNVQPEDVNISNEVSSPTEQQPEDVNISN
EGSSPNVQPEDANFSNEVSSPMEQPEDVNISNEGSSSNVQPEDVNISNEVSSPTEQQPEDVNISNEGSSPNVQPEDANFS
NEVSSPMEQPEDVNISNEGSSSNVQPEDINISNEGSSSNVRPEDVNFSNEVSALVEQPEDVNFSNQVSSLMEQPADVFSN
EVSLPREQPEDVNFSNEAVSSVEQPEDVDYLDEVLSPKEQSEDVDFLDEVSSPKEQPKDINFSNEVSSSKQQPDNLNFLN
EVSLSTEKPEDVSFLNEVSSSTELMCHENEEPQPIVGANTVYEDDEGGFYSRSLSSDSLLASRERSSEVTAQRLTGECMK
QDTPMSHSNEQPEQSDDDVLHGYMYRSPTARSFYGYDGSVSSYDGTDDQVLDRSLHQPNRTFKAREFVGPEERSRGKFLV
NSNLEMQRQTRNASSILSGKEHYPKKYGKWNRDDFPESTRYDQPVRNWMRLERGEFPSRLPFYGRDFPAGYENDIPSSPG
HPDYQHSSSFHSPDMPERHEQERIKLLKMLCELQDQINKKHNGRDPTRVGWKGKHIAKSYNHEASEEEIFNDLNYPRYPD
QYRTGRNWPQHRKFSRMAFSGEAPNSRRQADYSCLHCCPQDRWYSAQLRPPVPCCENGLHGARPGHRCYHHCTSTHSSPL
QCMDSEIPIWTHGAKSEDQGHKNHEAKLYWKEKPHQVKRHIQPIAGGAPFLTCYHCSHLLQLPADFLLFKRRCHGLRCGA
CYELLKFSVENRTHIVQYTPNAVDPRPPPPMETYKSIGSSSNMSKPEKSSTEIEELPPTAGSPLYRLMDYSSPSAMIYGK
YIYFFFLFILHTLHVHLVAVCTDINSERFLFDLFCWYSCSNFGIQTFFSYFSAYLGIYVVNNVVV*

DNA
ATGATCAGTGGACCAGCTACTAAAATTCGACTGGTTAGATGTCCCAAATGCTGGAAGCTTCTTCCAGAGGTGGCAGGAAT
TCCTCTATACCAGTGTGGTGGATGTGGCGTGTTTCTACGAGCCAAAAATCATGGAAACAGCACCAAAACTACCCCTTCAG
GCTCACATGAAACAGGTTCTGTTCAGAGGAATGAACTGGTGCATGTTTCTGAAAATGAAGAATCTAGTAGCTCGAGTCGA
GAGGCAATTCCCTCTTCCACAGGAGAATGTTCTTTGAACAAAGAAAATGGGAGGGATGATCTTGGGGATTGTCGTACAGA
GCAGCCTGAAGTGAACTTCTCAAATGGGGTTTCTTCAACAACAAAGCAGCCTGAAGATGCAAACTTCTCAGATAAAGTTC
CTTCATCAATAAACCTCTCGAATGAAGTTTCATCACTAATGAAGCACTTTGAAGATGTAAACATCTCAGATGAAGGTTCA
TCATCCAAAGTGCAGCCTGAAGAGGTGAACTTCTCGAATGAAGTTTCATCACCCATGGAGCAGCCTGAAGATGCAAACAT
CTCAGATGAAGGTTCATCATCCAAAGTGCAGCCTGAAGATGTGAACTTCTCGAATGAAGTTTCATCACCCATGGTGCAGC
CTGAAGATGTAAACATCTCAAATGAAGGTTCATCATCCAATGTGCATCCTGAAGATGTGAACTCCTCAAATGAAGTTTCA
TCACCCATGGAGCAGCAACCTGAAGATGTAAACATCTCAAACGAAGGTTCATCATCCAATGTGCAGCCTAAAGATGTGAA
CTTCTCAAATGAAGTTTCATCACCCATGGAGCAGCAGCCTGAAGATGTAAACATCTCAAATGAAGGTTCATCATCCAATG
TGCAGCCTGAAGATGTGAACATCTCAAATGAAGTTTCATCACCCACGGAGCAGCAGCCTGAAGATGTAAACATCTCAAAT
GAAGGTTCATCACCCAATGTGCAGCCTGAAGATGCGAACTTCTCAAATGAAGTTTCATCACCCATGGAGCAGCCTGAAGA
TGTAAACATCTCAAATGAAGGTTCATCATCCAATGTGCAGCCTGAAGATGTGAACATCTCAAATGAAGTTTCATCACCCA
CGGAGCAGCAGCCTGAAGATGTAAACATCTCAAATGAAGGTTCATCACCCAATGTGCAGCCTGAAGATGCGAACTTCTCA
AATGAAGTTTCATCACCCATGGAGCAGCCTGAAGATGTAAACATCTCAAATGAAGGTTCATCATCCAATGTGCAGCCTGA
AGATATAAACATCTCAAATGAAGGTTCATCATCCAATGTGCGGCCGGAAGATGTCAACTTCTCGAATGAAGTTTCTGCGT
TGGTGGAGCAACCTGAAGATGTGAACTTTTCTAATCAAGTTTCTTCACTGATGGAGCAGCCAGCAGACGTATTCTCAAAT
GAAGTTTCTTTGCCGAGAGAGCAGCCAGAAGACGTAAACTTCTCAAATGAAGCTGTTTCATCAGTGGAGCAGCCTGAAGA
TGTAGACTACTTGGATGAAGTTTTATCACCAAAGGAGCAGTCTGAAGATGTGGACTTCTTGGATGAAGTTTCATCACCAA
AGGAGCAGCCTAAAGATATAAACTTCTCGAATGAAGTTTCTTCATCAAAGCAGCAGCCTGACAATTTGAACTTCTTGAAT
GAAGTTTCTTTGTCAACGGAGAAGCCTGAAGATGTGAGCTTCTTGAATGAAGTTTCTTCGTCAACTGAGCTTATGTGTCA
TGAGAATGAAGAGCCACAACCCATAGTTGGAGCAAATACAGTATATGAAGATGATGAGGGTGGTTTTTACTCCAGAAGCT
TGAGTTCTGACAGCCTCCTGGCTTCAAGAGAAAGGAGTTCAGAAGTTACAGCTCAGAGGCTAACTGGGGAATGTATGAAA
CAGGATACTCCCATGTCTCACTCCAATGAACAACCAGAGCAGTCTGACGATGATGTTCTCCATGGATATATGTATAGATC
TCCAACAGCCAGAAGTTTCTATGGATATGATGGTAGTGTCTCTTCTTATGATGGAACTGATGATCAAGTCCTTGACCGAT
CTCTGCACCAACCCAACAGAACTTTCAAGGCTAGAGAATTTGTTGGTCCTGAAGAAAGATCCAGAGGTAAATTTCTGGTG
AATAGCAACCTAGAAATGCAACGTCAAACGAGGAATGCCTCATCAATTTTATCGGGTAAGGAGCATTACCCTAAGAAATA
CGGCAAGTGGAATAGAGATGACTTTCCGGAATCCACAAGATATGACCAGCCAGTCAGAAACTGGATGAGATTGGAAAGAG
GGGAATTTCCATCTAGATTGCCCTTCTATGGAAGGGATTTCCCTGCTGGCTATGAAAATGACATCCCTTCGAGTCCTGGA
CATCCTGACTACCAACACAGTTCGAGCTTTCATTCGCCTGACATGCCTGAGCGCCATGAACAGGAGAGGATAAAATTGTT
GAAAATGTTGTGTGAATTGCAAGATCAGATCAACAAAAAGCACAATGGAAGGGATCCCACCAGAGTCGGTTGGAAGGGGA
AGCATATTGCAAAGTCCTATAATCATGAAGCATCTGAGGAGGAAATTTTCAATGATTTAAACTATCCTAGGTATCCTGAC
CAATATAGGACTGGAAGAAACTGGCCCCAACATCGTAAGTTCTCGCGAATGGCTTTCTCAGGAGAGGCCCCAAACAGTAG
ACGCCAGGCTGATTATTCCTGCTTGCATTGTTGTCCCCAAGACAGGTGGTACTCAGCACAACTACGTCCACCTGTTCCAT
GTTGTGAAAATGGACTACATGGGGCCCGCCCTGGTCACAGATGTTATCATCACTGCACCTCTACTCACTCAAGTCCCCTA
CAGTGTATGGACTCTGAGATCCCCATATGGACCCATGGTGCAAAGTCTGAAGACCAGGGTCATAAAAATCACGAGGCGAA
GTTGTATTGGAAGGAGAAACCTCACCAGGTGAAGCGACATATCCAGCCCATAGCAGGTGGAGCTCCTTTCCTAACTTGCT
ATCATTGTTCACATCTGCTGCAGCTACCTGCAGATTTTCTCCTCTTTAAGAGGAGGTGCCATGGGCTCAGATGTGGTGCT
TGTTATGAGCTCCTTAAGTTTTCAGTTGAGAACAGAACTCATATAGTTCAATATACGCCAAATGCTGTAGACCCTCGGCC
TCCTCCCCCCATGGAAACGTACAAATCAATTGGGTCATCCTCCAATATGTCTAAACCTGAGAAATCATCCACAGAAATTG
AGGAACTGCCTCCAACAGCAGGTTCCCCACTTTATCGGCTCATGGATTATTCTTCACCAAGTGCAATGATATATGGAAAA
TATATATATTTTTTCTTTTTGTTTATTCTTCATACTCTGCATGTACACTTGGTTGCTGTTTGTACAGATATTAACTCAGA
AAGATTCCTATTTGATTTGTTCTGTTGGTATAGTTGTTCCAATTTTGGTATTCAGACCTTCTTTTCATATTTTAGTGCAT
ACTTGGGAATTTATGTGGTCAATAATGTAGTAGTATGA