Details for Grape vine Locus GSVIVT01030179001

Position : chr8 ( 5`- 10803380 .. 10799693 -3` )
Annotation :
External links : CoGe
PGDD synteny : GSVIVT01030179001

Protein [Map View]
MVVTLFAVLFIVPVVLGSLDPGFNDDVLGLIVFKAGLQDPESKLISWNEDDNNPCNWAGVKCDRQTNRVSELLLDNFSLS
GRIGRGLLRLQFLRILSGVNFSSNQLSGQLPDGIWSLYGLRSLDLSNNFLEGEIPEGIGSLYSLRAINLGKNKFSGRIPD
SIGSCLLLRLLDLSENLFSGGLPESMQRLRMCNYLSLRGNLLTGEIPNSIGNLLLLKELNLSSNQFGGSLPESMTKCTNL
VAMDVSHNLLTGNLPAWIFSLGLQTISLAGNKLNGSVEYSPLTSLQFLNMSRNSLIGSIPESIGELKTLHVLDLSNNQLN
GSIPFEIRGAVLLKELKLEKNFLTGKIPTQIEKCKSLTSLILSQNHLTGPIPAAIANLTSIENVDLSFNNLSGSLPKELT
NLSHLLSFNISHNNIQGELPSGGFFNTISPSSVSGNPSLCGSVVNRSCPSVHPKPIVLNPDSSSNSSNAGSFPSNRRHKI
ILSISALIAIGAAIFIAVGVLAITILNIHARSSMSHAAASPILSGGDDFSHSPTNDAQYGKLVMFSGDADFVAGAHALLN
KDCELGRGGFGAVYRTILRDGRSVAIKKLTVSSLIKSQEDFEREVKNLGKIRHHNLVALEGYYWTSSLQLLIYEYISSGS
LYKHLHEVPGKSCLSWRESGGEPKVGDFALARLLPMLDRYVLSSKIQSALGYMAPEFACRTVKITEKCDVYGFGVLVLEV
VTGRRPVEYMEDDVVVLCDMVRGALDEGKVEECVDRRLQGEFPADEAIPVIKLGLICASQVPSNRPDMGEVVNILELIQC
PSEGQALE*

DNA
ATGGTGGTGACACTTTTTGCTGTTCTGTTTATAGTTCCTGTTGTTTTGGGATCTCTGGACCCGGGCTTCAACGACGACGT
TTTGGGGTTGATTGTGTTCAAGGCTGGCCTCCAAGATCCGGAGTCGAAGCTCATATCTTGGAATGAAGACGATAACAACC
CCTGCAACTGGGCCGGTGTGAAATGCGATCGCCAGACCAACCGTGTTTCGGAGCTCCTCCTTGACAACTTCTCTCTTTCG
GGTCGGATTGGTAGAGGCCTTTTGCGGCTGCAATTCCTTCGGATATTGTCGGGAGTGAACTTCTCCTCTAATCAGCTTTC
TGGGCAATTGCCCGATGGAATCTGGTCTTTGTATGGGCTAAGATCGCTTGATTTATCCAATAATTTTCTGGAGGGTGAGA
TCCCAGAAGGAATTGGAAGTTTGTATAGTCTAAGAGCAATTAATTTGGGGAAGAACAAGTTCTCAGGCCGCATCCCAGAC
AGCATTGGAAGTTGTTTGCTTTTGAGATTGCTTGATTTGAGTGAAAATTTATTTTCCGGGGGGCTTCCAGAGTCGATGCA
GAGACTTAGAATGTGCAATTATCTTAGTTTACGGGGTAATTTGTTGACGGGAGAAATTCCAAATTCAATTGGAAACCTTT
TATTGTTGAAGGAACTAAATTTATCCTCTAATCAGTTCGGTGGAAGTTTGCCAGAGTCTATGACAAAATGCACTAACCTT
GTGGCTATGGATGTTAGCCACAACTTGTTGACAGGTAATCTTCCCGCCTGGATTTTTAGTTTGGGTTTACAAACTATTTC
ACTTGCGGGGAACAAACTCAATGGAAGTGTAGAATATTCTCCTCTAACTAGTTTGCAGTTCTTGAATATGTCGAGAAACT
CTCTGATTGGTTCTATTCCAGAAAGCATAGGTGAATTAAAAACTTTACATGTCCTTGATTTGAGCAACAATCAGCTAAAT
GGAAGCATTCCTTTTGAAATCAGAGGTGCAGTTTTGCTGAAGGAACTAAAGCTGGAGAAGAACTTTCTTACTGGGAAAAT
TCCAACCCAGATTGAGAAGTGCAAGTCACTGACCTCTTTGATCTTATCTCAGAACCACCTCACAGGTCCAATCCCTGCAG
CCATTGCTAACCTCACCAGCATTGAAAATGTGGACTTGTCATTTAACAATCTCTCAGGAAGTTTACCAAAGGAGCTAACA
AATCTCTCCCACCTCCTATCCTTCAATATCTCTCATAACAACATCCAAGGTGAATTGCCATCCGGTGGCTTCTTCAACAC
CATCTCCCCATCATCTGTCTCTGGTAATCCATCCCTTTGTGGCTCTGTTGTGAACCGCTCCTGCCCTTCTGTCCATCCCA
AACCCATTGTCCTTAATCCTGATTCTTCTTCCAACTCCTCTAATGCCGGCTCTTTCCCTTCAAATCGCCGTCACAAGATT
ATACTCAGCATCTCTGCTCTCATTGCCATTGGTGCAGCCATTTTCATTGCAGTTGGTGTTTTAGCGATCACTATCCTCAA
CATCCATGCCCGGTCATCTATGTCTCATGCTGCTGCCAGCCCAATATTATCTGGTGGGGATGATTTTAGTCATTCCCCCA
CTAATGATGCTCAGTATGGCAAGCTTGTCATGTTCTCTGGTGATGCTGACTTTGTTGCTGGGGCACATGCATTACTCAAC
AAGGATTGTGAACTCGGTCGTGGTGGGTTTGGAGCTGTTTATCGAACAATCCTTCGAGATGGGCGTTCAGTTGCTATCAA
GAAGTTGACTGTTTCAAGTTTGATCAAGTCCCAAGAAGATTTTGAGAGGGAAGTGAAAAACCTTGGAAAGATCAGGCACC
ATAATCTAGTGGCACTCGAAGGGTATTACTGGACTTCATCCTTACAGCTGCTCATTTATGAATACATCTCCAGTGGGAGT
TTGTATAAACATCTCCATGAGGTTCCAGGCAAAAGCTGCCTCTCTTGGCGAGAGAGTGGTGGTGAACCCAAGGTGGGAGA
CTTTGCCTTGGCAAGGCTGTTACCAATGTTAGACCGCTATGTTCTAAGCAGCAAGATTCAGAGTGCACTTGGATACATGG
CACCTGAATTTGCATGTCGAACAGTGAAAATAACCGAGAAATGCGATGTGTATGGGTTTGGTGTCTTGGTTCTGGAGGTA
GTGACCGGGCGGAGACCTGTGGAATACATGGAGGATGATGTGGTTGTCCTTTGTGACATGGTGAGGGGAGCACTTGATGA
AGGTAAGGTGGAAGAATGTGTTGACAGGAGGCTCCAGGGGGAATTTCCAGCAGATGAGGCTATTCCAGTGATAAAACTTG
GGCTGATATGTGCATCTCAGGTGCCATCAAATCGGCCAGACATGGGAGAAGTGGTGAACATTTTAGAACTGATCCAATGC
CCGTCAGAAGGCCAAGCATTAGAATGA