Details for Grape vine Locus GSVIVT01030174001

Position : chr8 ( 5`- 10846082 .. 10843901 -3` )
Annotation :
External links : CoGe
PGDD synteny : GSVIVT01030174001

Protein [Map View]
MRESKLRGFILLSIGSGCDHAREIKALPLDLHLVSMERHTDATMSTMECTWSEKISGDRKRAIDELLRGRSFTKQLRSVL
LGGDQQESAQDLLVKISRSFTDTLSILNSGESDEAVSQIPASGQLYSPGWHGRRSEESCESGKSSTKDRRGCYKRRKNSQ
SWIRITPNFHDDGYAWRKYGQKVILNAKHQRSYYRCTHKHDQGCMATKQVQMTEEEPPMYKTTYHGQHTCKSMLKSSQIM
VENSTARDSSILLSFESNNQDDSNAFFSSFPLIKQEEEIPNDDQELTTFESNLGSDHGDVLSGVNSSCTDSTHSLDDMMM
DFDDVLIGFEC*

DNA
ATGAGAGAAAGTAAGTTACGTGGCTTCATACTATTGAGCATTGGGAGTGGGTGTGATCATGCGCGTGAGATAAAAGCTCT
TCCTCTTGATCTTCACTTGGTGAGTATGGAGAGGCACACAGACGCCACCATGAGCACAATGGAGTGCACCTGGTCGGAAA
AGATCTCCGGCGATCGGAAAAGAGCCATCGACGAGCTGCTTCGAGGTCGCTCCTTCACCAAGCAGCTTCGCAGCGTCCTC
CTCGGAGGGGATCAACAGGAGTCGGCCCAGGATCTTCTAGTGAAAATCTCGAGGTCATTCACCGATACTCTTTCTATATT
GAATTCCGGCGAGTCCGACGAGGCCGTCTCACAGATTCCGGCGAGTGGTCAGCTGTATTCGCCGGGTTGGCATGGCCGGA
GGTCGGAGGAATCTTGCGAGAGTGGTAAGAGTTCCACCAAGGATCGCAGGGGCTGTTACAAGCGAAGGAAGAATTCGCAA
TCTTGGATCAGAATCACCCCTAATTTTCACGATGACGGTTATGCCTGGCGAAAATACGGACAAAAAGTCATACTCAATGC
TAAACATCAAAGAAGCTACTATAGGTGCACCCACAAGCATGACCAGGGCTGCATGGCAACCAAACAGGTTCAGATGACTG
AAGAGGAGCCCCCAATGTACAAAACCACATACCACGGCCAGCACACATGCAAAAGCATGCTGAAGTCATCTCAGATTATG
GTGGAAAATTCTACTGCAAGAGATTCTTCCATTCTGCTCAGCTTTGAATCAAACAATCAAGATGATAGCAACGCCTTTTT
CTCATCATTCCCCTTGATAAAACAAGAGGAAGAGATCCCAAATGATGATCAGGAGCTCACCACATTTGAATCCAATCTGG
GGTCTGATCATGGTGATGTCCTTTCTGGGGTTAACTCTTCTTGTACGGACAGCACTCACAGTTTGGATGATATGATGATG
GACTTTGATGATGTTCTTATCGGTTTTGAGTGTTAG