Details for Grape vine Locus GSVIVT01025873001

Position : chr8 ( 5`- 10937161 .. 10934273 -3` )
Annotation : [B2G] unnamed protein product [Vitis vinifera]
External links : CoGe
PGDD synteny : GSVIVT01025873001

Protein [Map View]
MGQCFMKHHNDDDDSDHNAAFASGNVHLITTKENWEEKLAEASKDGKIVIANFSATWCGPCKMIAPFYCELSEAHPSLMF
LTVDVDELSEFSSSWDIKATPTFFFLRDGQQVDKLVGANKPELQKKITAILDSMTQCNK*

DNA
ATGGGACAGTGCTTTATGAAGCATCACAATGATGATGATGATTCCGATCACAATGCTGCATTTGCTAGTGGAAATGTACA
CCTTATCACTACCAAAGAAAATTGGGAGGAGAAGTTGGCAGAAGCAAGCAAAGATGGAAAGATTGTGATTGCAAATTTTA
GTGCAACATGGTGTGGTCCTTGTAAAATGATTGCACCATTCTACTGCGAACTATCTGAGGCACACCCTTCTCTGATGTTT
CTAACTGTTGATGTTGATGAACTAAGTGAATTCAGTTCTTCATGGGATATCAAAGCCACTCCAACCTTTTTCTTCCTCAG
AGATGGGCAACAGGTAGACAAGCTTGTGGGGGCGAACAAACCTGAGCTACAGAAGAAGATAACTGCTATTTTAGATTCCA
TGACCCAGTGTAATAAATGA