Details for Grape vine Locus GSVIVT01011463001

Position : chr14 ( 5`- 29813645 .. 29808409 -3` )
Annotation :
External links : CoGe
PGDD synteny : GSVIVT01011463001

Protein [Map View]
MRLCLIHPSRQLSIIGGRLLFYYPSPPDSGYFSGNFSEFRRNLSLIFSFSFFLIISVFCGQLKTMGEVFDGYERQYCELS
ANLSKKCTTASLLDGEQKRQQISEIKAGLDEADSLIRKMDLEARGLQPNVKAVLLAKLREYKSDLNNLKSEVKRIASANS
NQAARDDLLESGMADAMSVSANQRARLMMSTDRLNQSSDRIKESKRTMLETEELGVSILQDLHQQRQSLLHANDTLHGVD
DNVSRSKKILTNMSRRMSRNKCIIGSIIAVLVVVIALILYFKLSK*

DNA
ATGCGCCTATGCCTCATTCACCCATCCAGACAGCTGTCAATCATAGGAGGAAGGTTACTTTTTTACTATCCATCGCCACC
GGACTCAGGCTACTTTTCCGGCAACTTCTCTGAATTCCGGCGAAATTTGAGCTTGATTTTTTCTTTTTCTTTTTTTCTCA
TCATCTCAGTGTTTTGTGGACAATTGAAGACGATGGGTGAGGTATTTGATGGATACGAGCGCCAGTACTGTGAGCTTTCA
GCCAATTTGTCCAAGAAGTGTACGACAGCTAGTCTTCTGGATGGAGAGCAGAAGAGGCAACAAATTTCTGAAATAAAAGC
CGGATTGGATGAAGCAGACTCTCTGATACGGAAAATGGACCTTGAGGCTAGAGGTCTGCAGCCGAATGTAAAGGCTGTAC
TTCTTGCTAAGCTAAGGGAATACAAATCTGATCTGAACAATTTGAAAAGTGAGGTTAAAAGAATTGCATCAGCTAACTCA
AATCAGGCTGCCCGAGATGACTTATTAGAATCAGGAATGGCTGATGCAATGTCGGTATCGGCTAATCAAAGAGCACGATT
GATGATGTCAACAGACAGATTAAATCAGTCCAGTGATAGAATTAAGGAAAGTAAAAGAACCATGCTGGAGACAGAAGAGC
TTGGTGTTTCAATTCTTCAAGATTTGCATCAACAACGACAATCGCTCTTACATGCCAATGACACGCTGCATGGAGTAGAT
GACAACGTTAGCAGAAGTAAGAAAATTTTGACCAACATGTCAAGGAGGATGAGCAGGAACAAGTGTATTATCGGCTCCAT
AATTGCAGTCCTCGTTGTTGTCATTGCCTTGATCTTGTACTTCAAACTCTCCAAATAG