Details for Grape vine Locus GSVIVT01011454001

Position : chr14 ( 5`- 29773172 .. 29776780 -3` )
Annotation : [B2G] transmembrane emp24 domain-containing protein bai isoform 1
External links : CoGe
PGDD synteny : GSVIVT01011454001

Protein [Map View]
MSVGKYSVINPNEGFPLPDTHKITAQVSSPYGNNYHTGDHIESGNFAFTAAEEGDYTACFWAPQHKPPLTVTIDFDWRTG
VAAKDWSKVAKKGQVEVMELELKKLYDTVTSIHEEMFYLREREEEMQELNRATNSKMATFSFLSLLVCLSVAGLQLWHLK
TFFERKKLL*

DNA
ATGAGTGTCGGCAAGTACAGCGTCATCAATCCGAACGAGGGCTTCCCTTTGCCGGACACGCACAAGATTACAGCTCAGGT
TTCTTCTCCGTACGGGAACAATTATCATACTGGGGATCATATAGAATCTGGTAATTTTGCGTTTACTGCAGCTGAAGAAG
GTGACTACACCGCTTGCTTCTGGGCGCCTCAGCACAAGCCTCCATTAACAGTAACTATTGATTTTGATTGGAGAACTGGT
GTTGCTGCTAAGGACTGGTCCAAGGTTGCTAAGAAAGGGCAGGTTGAGGTGATGGAACTGGAGTTGAAGAAGCTGTACGA
CACAGTCACATCCATTCATGAAGAAATGTTTTATCTTCGTGAGAGGGAGGAAGAAATGCAAGAACTTAATCGAGCAACCA
ACTCTAAGATGGCCACATTTAGTTTCCTCTCACTCTTAGTTTGCTTGTCAGTGGCCGGATTGCAATTATGGCACCTGAAG
ACATTCTTTGAAAGGAAGAAGCTCCTTTAG