Details for Grape vine Locus GSVIVT01008476001

Position : chr17 ( 5`- 1537423 .. 1538385 -3` )
Annotation :
External links : CoGe
PGDD synteny : GSVIVT01008476001

Protein [Map View]
MAVVRDRRQLNLRLPLPEISERRPRFPLPLPPTNLPFSSGATTAADLEKIEVIGHGNGGTVYKVQHKRTAANYALKVVHG
DCDPTVRRQPSGDIAILMEYMDAGTLKTLLETKGTFSEVDLAGVAGQVLNGLSYLHSHKIIHRDIKPANLLVNGNMEVKI
ADFGVSKIMRRMLDSCNSYVGTCAYMSPERFDPDSHGSNYDGYSGDIWSLGLTLLELYVADDLI*

DNA
ATGGCAGTAGTCCGAGACCGCCGGCAGCTCAACCTCCGCCTCCCCTTGCCTGAAATCTCCGAGCGCCGTCCCCGATTCCC
ACTTCCCCTTCCTCCCACCAATCTCCCGTTCTCCTCCGGCGCCACTACCGCCGCCGACCTTGAGAAGATCGAAGTGATCG
GCCACGGGAACGGCGGCACCGTCTACAAGGTCCAGCACAAGCGCACTGCAGCGAACTACGCGCTCAAGGTGGTCCACGGC
GACTGCGACCCCACCGTCCGCCGTCAGCCCTCCGGTGACATCGCGATTTTAATGGAGTACATGGACGCCGGTACCTTAAA
AACCCTCCTGGAAACCAAAGGCACTTTCTCGGAAGTGGATCTCGCTGGCGTCGCCGGTCAGGTGCTGAACGGCCTCAGTT
ACCTCCACAGCCACAAGATCATCCACAGAGACATCAAACCCGCAAATCTTTTGGTGAACGGGAACATGGAGGTGAAGATC
GCCGATTTCGGAGTGAGCAAGATCATGCGCCGCATGCTCGACTCTTGCAACTCCTACGTGGGCACCTGCGCCTACATGAG
CCCGGAGCGGTTCGACCCCGACTCCCACGGCTCCAATTACGACGGCTACTCCGGCGATATCTGGAGCTTAGGTCTCACCC
TATTAGAACTCTACGTCGCCGATGATCTGATCTGA