Details for Banana Locus GSMUA_Achr11G23660

Position : chr11 ( 5`- 23485786 .. 23486962 -3` )
Annotation :
External links : CoGe
PGDD synteny : GSMUA_Achr11G23660

Protein [Map View]
MAIPRFSLSDALFLLFSSSCFLARGTLGDSYDWQSAHATFYGGGDASGTMGGACGYGDLYSQGYGTNTAALSTALFNDGL
SCGSCYELKCDDDPRWCLPGSIVITATNFCPPNYALPSDDGGWCNPPRPHFDMAEPAFLQIAQYRAGIVPVAFRRQKGGV
RFTINGHSYFNLVLITNVAGAGDVCAVSIKGSRTGWQVMSRNWGQNWQSNAYLDGQSLSFQVTTSDGRTITSYDVVPTDW
QFGQTFEGGQF*

DNA
ATGGCCATCCCCAGGTTCTCTCTCTCCGACGCGCTCTTTCTTCTCTTCTCTTCCTCGTGCTTCCTCGCCCGAGGAACGCT
GGGTGACTCTTACGATTGGCAGAGCGCGCATGCGACGTTCTATGGTGGCGGCGACGCCTCTGGTACAATGGGAGGTGCTT
GTGGGTATGGCGATCTCTACAGTCAAGGTTACGGCACGAACACCGCCGCCCTGAGCACGGCCCTTTTCAATGACGGGCTG
AGCTGCGGGTCGTGTTACGAGCTGAAGTGCGACGATGACCCGCGGTGGTGCCTGCCGGGCTCGATCGTGATCACTGCCAC
CAACTTTTGCCCCCCAAACTACGCTCTTCCCAGCGATGATGGAGGGTGGTGCAATCCTCCTCGCCCGCACTTCGACATGG
CCGAGCCGGCGTTTCTGCAAATCGCTCAGTACCGGGCTGGGATCGTGCCGGTAGCCTTCAGAAGGCAAAAAGGAGGCGTC
AGGTTCACCATCAATGGCCACTCCTACTTCAACCTGGTCTTGATCACCAACGTGGCGGGCGCCGGCGACGTATGTGCGGT
CTCCATCAAGGGCTCCCGGACCGGGTGGCAGGTGATGTCCCGGAACTGGGGCCAGAACTGGCAGAGCAACGCGTATCTCG
ATGGCCAAAGCCTCTCCTTCCAAGTTACCACCAGCGACGGCCGGACCATCACCAGCTACGATGTCGTGCCCACCGATTGG
CAGTTCGGCCAGACCTTCGAAGGAGGACAATTTTAG