Details for Banana Locus GSMUA_Achr11G23650

Position : chr11 ( 5`- 23477409 .. 23482763 -3` )
Annotation :
External links : CoGe
PGDD synteny : GSMUA_Achr11G23650

Protein [Map View]
MPSKSLIPPPTTPNPNLPCPNAPVVPPSMCGGGGDLDPAPHFGGPHHRRAHSELAFRISEDLHLGPASEDDVFRTYMDVE
KIGSGMEDGEAPASEAAEHSGPRDRNSVDASSSRGEGVFGDVMEAKKAMPPEKLAELAVIDPKRAKRILANRQSAARSKQ
RKANYIVELERKVQTLQTEATTLSAQLTLFQKDISELATENAGLKLWLQSMEQQAQLNDGVNDGLKQEVERLKIATGEKV
ERSEAYNLGLMNLPFLPFVMPSQEQPRNHQRGFEFQAQIQQSQLDNNSVPSNMMQQGHLMVLPGMLSFELED*

DNA
ATGCCGTCGAAATCCTTGATCCCTCCCCCGACGACTCCCAATCCCAACCTCCCCTGCCCCAACGCCCCCGTCGTGCCGCC
GTCTATGTGCGGCGGCGGCGGCGACCTTGATCCCGCGCCGCATTTCGGAGGACCCCACCACCGGCGGGCCCACTCCGAGC
TGGCCTTCCGGATCTCCGAGGACCTCCATCTGGGCCCCGCCTCCGAGGACGACGTCTTCCGGACTTACATGGACGTGGAG
AAGATCGGATCGGGGATGGAGGACGGTGAAGCACCCGCTTCGGAAGCAGCCGAGCACTCGGGCCCTCGGGATCGCAACTC
GGTCGATGCGTCCAGCTCTAGAGGCGAGGGAGTGTTCGGGGACGTGATGGAGGCCAAGAAAGCCATGCCGCCCGAGAAGC
TTGCGGAATTGGCGGTGATCGACCCAAAGAGGGCCAAGAGAATTCTAGCAAATCGTCAGTCTGCAGCTCGCTCGAAACAA
CGGAAAGCAAATTATATTGTAGAACTTGAGCGAAAAGTACAGACTCTTCAAACCGAAGCTACCACTCTTTCAGCACAGCT
TACACTGTTCCAGAAAGATATATCCGAGTTGGCCACTGAAAATGCAGGACTGAAGTTATGGCTACAATCTATGGAGCAAC
AAGCTCAGTTGAATGATGGCGTTAATGATGGGTTGAAGCAGGAAGTTGAAAGGCTTAAGATTGCAACCGGGGAAAAAGTG
GAGAGAAGCGAGGCATATAATCTAGGACTCATGAACCTTCCTTTCTTACCGTTTGTGATGCCTTCACAGGAGCAACCACG
AAATCATCAACGAGGCTTTGAATTTCAAGCTCAGATTCAGCAGTCTCAACTTGATAACAACAGTGTGCCGTCGAATATGA
TGCAGCAGGGTCACCTTATGGTACTGCCAGGAATGCTTTCTTTTGAGCTGGAAGATTAA