Details for Banana Locus GSMUA_Achr11G23610

Position : chr11 ( 5`- 23452985 .. 23455324 -3` )
Annotation :
External links : CoGe
PGDD synteny : GSMUA_Achr11G23610

Protein [Map View]
MKAAGRKNIRRASKEDGISLREGQGIMKVVSLRGSNVIEVMDAKGVKSLALFPAKFQKSFWIKTGSFVVVDESGREKALE
SGSKIACMVSQVLFHDQVRALEKSLDWPAIFRTATPDDSHQESKSQCKEETGSDSEDGLPPIEANLNRNRPIELYSDSDS
DSCPAS*

DNA
ATGAAAGCGGCAGGTAGAAAGAATATTAGGAGGGCGTCGAAGGAGGACGGTATTTCGCTCCGAGAAGGCCAGGGCATCAT
GAAAGTTGTGTCTCTTCGCGGCTCCAACGTTATCGAGGTCATGGATGCCAAAGGTGTTAAATCTCTCGCTTTATTTCCAG
CCAAATTTCAGAAGAGCTTTTGGATTAAAACAGGAAGTTTCGTTGTGGTAGATGAAAGTGGAAGGGAGAAAGCCCTTGAG
TCAGGTAGCAAGATAGCATGTATGGTTTCACAAGTTCTCTTCCATGACCAAGTTCGAGCACTTGAAAAATCTTTGGACTG
GCCTGCTATATTCAGAACCGCAACACCTGATGATAGCCACCAAGAGTCGAAATCACAATGCAAAGAAGAAACGGGTTCTG
ATAGTGAGGATGGCCTCCCACCAATCGAAGCAAATCTGAACAGAAATAGGCCTATTGAGCTGTATTCGGATAGCGATTCA
GATTCTTGTCCTGCTTCCTAG