Details for Eucalyptus Locus Eucgr.K02287

Position : scaffold_1 ( 5`- 29992999 .. 29994186 -3` )
Annotation :
External links : CoGe
PGDD synteny : Eucgr.K02287

Protein [Map View]
MALVRHRRQLNLRLSLPEPSDLLPPFPAPSASSSSSSAAPAPPTISPSDLETIHVLGHGNGGTIYKVRHRRTSAVYALKV
IRSSSDASARRGARREVEVLRRTADSPNVVHCHGSFEEPCGDVAILLEYMDLGNLGSVLRNYGPLSESDLADIARQVLNG
LDQLHSRKIIHRDIKPSNLLVNSKMEVKIADFGVSKIMCRTLEACDSYVGTCAYMSPERFDPDSNGGSYNGYAGDVWGLG
LTLLELYLGYFPFLDPGQRPDWASLVCAICFGEIPSLPERASGEFRSFVECCLQKESGKRWTVSQLLTHPFVCKDPTSGA
*

DNA
ATGGCCCTCGTCCGCCACCGCCGGCAACTCAACCTCCGCCTATCCTTGCCGGAGCCCTCCGATCTCCTCCCACCCTTCCC
CGCCCCCTCCGCCTCCTCCTCCTCCTCCTCTGCTGCCCCCGCACCCCCCACCATCTCCCCCTCTGACCTCGAGACCATCC
ACGTCCTCGGCCACGGCAACGGCGGCACCATCTACAAGGTCCGGCACAGGCGCACCTCCGCTGTCTACGCCCTCAAGGTC
ATCCGCTCCAGCTCCGATGCCTCCGCCCGCCGCGGTGCCCGACGCGAGGTCGAGGTCCTGCGCCGCACCGCCGACTCCCC
CAACGTGGTCCACTGCCACGGCTCCTTCGAGGAGCCGTGCGGGGACGTCGCCATCCTCCTCGAGTACATGGACCTGGGGA
ACCTGGGGTCGGTGCTCCGGAACTACGGCCCGCTCAGTGAGTCGGACCTCGCCGACATCGCTCGCCAGGTCCTGAACGGT
CTCGACCAACTCCACTCGCGCAAGATCATACACCGAGACATCAAGCCATCGAATCTGCTCGTGAACTCGAAGATGGAGGT
CAAGATCGCCGACTTCGGCGTGAGCAAAATCATGTGCAGGACGCTCGAAGCGTGCGACTCGTACGTCGGCACGTGCGCCT
ACATGAGTCCGGAGCGGTTCGACCCGGACTCCAACGGAGGCAGTTATAACGGTTACGCGGGGGACGTGTGGGGGTTGGGG
CTGACCCTGCTGGAGCTGTACCTGGGCTACTTTCCGTTCCTGGATCCGGGACAGCGGCCCGATTGGGCCAGCCTCGTGTG
CGCCATCTGCTTCGGCGAGATACCGAGCCTGCCGGAGCGGGCAAGCGGCGAGTTCCGGAGCTTCGTCGAGTGCTGCTTGC
AGAAGGAGTCCGGCAAGAGGTGGACGGTGTCGCAGCTTCTGACCCACCCGTTTGTGTGCAAGGATCCGACATCCGGGGCC
TGA