Details for Eucalyptus Locus Eucgr.K02281

Position : scaffold_1 ( 5`- 29937989 .. 29939849 -3` )
Annotation :
External links : CoGe
PGDD synteny : Eucgr.K02281

Protein [Map View]
MGLFLSRNLVNFLVSFSAKKGPVELFPVQIKDVVSLVSRTGRHLQRYEKDRRQVVGCIPYRYRKTDQSSGGGGEELEFLV
VSSPKGQRMMFPKGGWELDETIEQAALRESAEEAGVTGTLECKLGEWRYKSKSNGSFHDGHMFPLLVQKELDFWPEKHVR
QRRWVTADEAKELCQQLWMKEALELLIQRLRQQKNGQAVERQRA*

DNA
ATGGGTCTGTTCCTTTCCAGGAACCTCGTGAATTTCCTCGTCTCCTTCTCGGCGAAGAAGGGCCCCGTCGAGCTCTTCCC
CGTCCAGATCAAGGACGTGGTCTCTCTGGTCTCCCGCACGGGCAGGCACTTGCAGCGCTACGAAAAGGATCGTCGCCAAG
TCGTCGGATGCATACCCTACAGATACAGGAAGACTGATCAATCATCTGGCGGTGGGGGTGAAGAATTGGAGTTTCTTGTT
GTCAGTTCACCGAAGGGCCAGCGAATGATGTTTCCCAAGGGAGGATGGGAACTGGATGAGACTATAGAGCAGGCCGCTTT
GCGCGAATCAGCAGAAGAAGCCGGAGTAACGGGCACTCTCGAGTGTAAATTGGGTGAATGGCGATATAAGAGCAAAAGCA
ATGGCAGCTTTCATGATGGCCATATGTTCCCTTTACTCGTTCAAAAGGAACTCGATTTTTGGCCGGAGAAGCACGTCAGG
CAAAGACGATGGGTGACAGCTGACGAAGCGAAAGAATTGTGTCAACAGCTGTGGATGAAGGAAGCTCTAGAATTATTAAT
TCAAAGATTGAGGCAACAAAAAAATGGGCAGGCAGTTGAAAGACAGCGTGCATAG