Details for Eucalyptus Locus Eucgr.H00640

Position : scaffold_8 ( 5`- 8601515 .. 8605074 -3` )
Annotation :
External links : CoGe
PGDD synteny : Eucgr.H00640

Protein [Map View]
MNDKALVTKDLHARHTKILEGLLKLPENRECADCQSKAPRWASVNLGIFICMQCSGIHRSLGVHISKVRSTTLDTWLPEQ
VAFMQCMGNKRSNKYWEAELPPDYDRSEIQKFISTKYDEKRWVAKDAPQPSFEGISLCRVSSEPVEDRSKASIPKKMRNF
SLEEEILTSHVAPATPPPARHRGVSSNFS*

DNA
ATGAACGACAAGGCATTGGTCACCAAGGACCTCCACGCCAGGCACACCAAGATACTCGAGGGTCTTCTCAAACTTCCAGA
AAATAGGGAGTGTGCAGATTGCCAAAGCAAGGCTCCTCGATGGGCAAGTGTGAATCTAGGAATTTTCATATGCATGCAAT
GTTCCGGGATCCATCGGAGTCTTGGAGTACATATTTCAAAGGTTAGATCGACTACTTTGGATACATGGCTACCAGAACAG
GTTGCTTTTATGCAGTGTATGGGAAACAAGAGGTCCAACAAATACTGGGAAGCAGAACTTCCACCGGATTATGACAGAAG
TGAGATTCAGAAATTCATTTCTACCAAGTATGATGAGAAAAGATGGGTTGCAAAAGATGCACCGCAGCCAAGTTTTGAAG
GCATCAGTCTGTGCCGCGTCTCCAGTGAGCCTGTAGAAGACAGATCAAAAGCTTCCATACCTAAGAAGATGAGAAACTTT
TCTCTGGAAGAAGAGATTCTCACATCGCATGTAGCACCGGCAACTCCACCTCCAGCAAGACACCGAGGGGTATCTTCAAA
TTTCTCTTAG