Details for Eucalyptus Locus Eucgr.H00620

Position : scaffold_8 ( 5`- 8367628 .. 8370546 -3` )
Annotation :
External links : CoGe
PGDD synteny : Eucgr.H00620

Protein [Map View]
MELTLISPLNRPLSLSRPKRCRRPAAAAARAAGSSPELSEVRVCTNRTCRKQGSFQTLEALSGLAPPGVAVKACGCLGRC
GSGPNLALLPEGVIVSHCGTAARAARIFWSDDDGGVLRSLEALALRKRAESELEKGNFSDAEVLLTQAIAIRPCGGIHVM
YKDRSVARLGMCNYSGALEDAKEALTLSPQYIEAQLCQGDAFMEMEQFDEAEKSYFMSLQIDPSIRRSRSFKDRVERLQQ
KLDAADIS*

DNA
ATGGAGCTCACCTTAATCTCTCCCCTCAACCGCCCGCTCTCCCTCTCTCGTCCCAAACGGTGCCGCCGCCCCGCCGCCGC
CGCCGCGCGCGCGGCGGGCTCCTCGCCGGAGCTCTCCGAGGTCAGGGTCTGCACCAACCGCACCTGCCGCAAGCAGGGCT
CGTTCCAGACCCTGGAGGCCCTCTCCGGCCTCGCCCCGCCCGGCGTCGCCGTCAAGGCCTGCGGTTGCCTGGGCCGGTGC
GGCTCCGGCCCCAACCTCGCCCTCCTGCCCGAGGGCGTCATCGTCAGCCACTGCGGCACCGCCGCGCGCGCCGCCCGGAT
CTTCTGGAGCGACGACGACGGCGGCGTGCTAAGGAGCCTGGAGGCGCTCGCGCTGAGGAAGAGAGCCGAGAGCGAGCTGG
AGAAGGGGAATTTCTCCGATGCCGAGGTGCTGCTAACTCAGGCTATAGCAATAAGGCCATGCGGTGGGATCCATGTGATG
TATAAAGACAGATCTGTTGCGAGGTTGGGAATGTGCAACTATAGCGGGGCTCTTGAAGATGCAAAAGAAGCGTTGACATT
ATCTCCTCAGTACATTGAGGCTCAATTATGTCAGGGAGATGCTTTCATGGAAATGGAACAGTTTGATGAAGCTGAGAAGT
CCTATTTTATGTCCTTACAGATAGATCCCTCCATTCGTCGTTCTAGATCATTCAAGGATCGAGTTGAAAGGCTTCAACAG
AAACTAGATGCTGCAGATATCTCTTGA